Knowledge

Chlorotoxin

Source 📝

339:
InChI=1S/C158H249N53O47S11/c1-77(2)55-96-138(241)205-105(144(247)186-86(125(165)228)28-18-47-173-156(166)167)70-264-262-68-103-131(234)177-63-115(217)176-64-116(218)183-87(25-12-15-44-159)128(231)178-65-117(219)184-88(29-19-48-174-157(168)169)129(232)179-66-118(220)185-89(26-13-16-45-160)133(236)202-107-72-267-269-75-110-149(252)195-98(56-81-23-10-9-11-24-81)143(246)208-124(80(5)213)154(257)209-123(79(4)212)153(256)199-102(61-122(226)227)141(244)196-99(58-83-62-172-76-181-83)139(242)189-92(37-39-113(163)215)136(239)190-94(42-53-260-7)132(235)182-78(3)126(229)187-91(30-20-49-175-158(170)171)134(237)188-90(27-14-17-46-161)135(238)203-108(73-266-265-71-106(146(249)193-96)204-137(240)93(38-40-114(164)216)191-151(254)111-31-21-50-210(111)119(221)67-180-130(233)97(194-147(107)250)57-82-33-35-84(214)36-34-82)148(251)198-100(59-120(222)223)140(243)197-101(60-121(224)225)142(245)206-109(150(253)201-103)74-268-263-69-104(200-127(230)85(162)41-52-259-6)145(248)192-95(43-54-261-8)155(258)211-51-22-32-112(211)152(255)207-110/h9-11,23-24,33-36,62,76-80,85-112,123-124,212-214H,12-22,25-32,37-61,63-75,159-162H2,1-8H3,(H2,163,215)(H2,164,216)(H2,165,228)(H,172,181)(H,176,217)(H,177,234)(H,178,231)(H,179,232)(H,180,233)(H,182,235)(H,183,218)(H,184,219)(H,185,220)(H,186,247)(H,187,229)(H,188,237)(H,189,242)(H,190,239)(H,191,254)(H,192,248)(H,193,249)(H,194,250)(H,195,252)(H,196,244)(H,197,243)(H,198,251)(H,199,256)(H,200,230)(H,201,253)(H,202,236)(H,203,238)(H,204,240)(H,205,241)(H,206,245)(H,207,255)(H,208,246)(H,209,257)(H,222,223)(H,224,225)(H,226,227)(H4,166,167,173)(H4,168,169,174)(H4,170,171,175)/t78-,79+,80+,85-,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,123-,124-/m0/s1
217: 316: 363:
C1C(=O)N(C(=O)N(C(=O)N2CSSC3C(=O)N(C(=O)N(CSSC4C(=O)NCC(=O)NCC(=O)N(C(=O)NCC(=O)N(C(=O)NCC(=O)N(C(=O)N(CSSC(C(=O)N(C(=O)N(C(=O)N(C(=O)N(C(=O)N(C(=O)N(C(=O)N(C(=O)N1)CCSC)CCC(=O)N)CC5=CNC=N5)CC(=O)O)(C)O)(C)O)CC6=CC=CC=C6)NC(=O)7CCCN7C(=O)(NC(=O)(CSSC(C(=O)N4)NC(=O)(NC(=O)(NC2=O)CC(=O)O)CC(=O)O)NC(=O)(CCSC)N)CCSC)C(=O)N(C(=O)NCC(=O)N8CCC8C(=O)N(C(=O)N3)CCC(=O)N)CC9=CC=C(C=C9)O)CCCCN)CCCNC(=N)N)CCCCN)C(=O)N(CCCNC(=N)N)C(=O)N)CC(C)C)CCCCN)CCCNC(=N)N
581:
and pincer legs that was complete about forty seconds later. Within ±90 s of injection the tail musculature was immobilized. No recovery was noted for 6 hours, at which time the crayfish were destroyed. At 0.5 μg/g, chlorotoxin induced the same progressive paralysis with a slower onset. Recovery of crayfish was noted after 2 hours. The injection on insects produced similar results to those observed in crayfish.
446: 24: 580:
Chlorotoxin immobilizes the envenomated prey. Duration of paralysis depends on the amount of chlorotoxin injected. In crayfish, chlorotoxin at 1.23-2.23 μg/g body wt produced a loss of motor control beginning about 20 seconds after injection which progressed to a rigid paralysis of the walking
608:
TM-601 which is the synthetic version of chlorotoxin is under phase II clinical trial. Iodine-131-TM-601 is used to treat malignant glioma. TM-601 is also a candidate for targeting gliomas because it crosses blood-brain and tissue barriers and binds to malignant brain tumor cells without affecting
632:
spectrum and hence can be visualized in the operating room with the aid of infrared glasses. Studies in mouse models have shown that CTX:Cy5.5 can identify tumors with as few as 2000 cancer cells, making it 500 times more sensitive than MRI. Treated animals exhibited no neurologic or behavioral
604:
A report showed the anti-invasive effect of chlorotoxin on glioma cells mediated by its interaction with MMP-2, which allows the penetration of normal and tumor cells through tissue barriers. Chlorotoxin exerts a dual effect on MMP-2: it inhibits the enzymatic activity of MMP-2 and causes a
571:
Using a recombinant chlorotoxin it was demonstrated that chlorotoxin specifically and selectively interacts with MMP-2 isoforms which are specifically upregulated in gliomas and related cancers, but are not normally expressed in brain.
627:
to distinguish cancer cells from the surrounding normal cells. This could enable surgeons to remove cancerous cells without injuring the surrounding healthy tissue. CTX:Cy5.5 is a fluorescent molecule emitting photons in the near
589:
The fact that chlorotoxin binds preferentially to glioma cells compared with non-neoplastic cells or normal brain has allowed the development of new methods for the treatment and diagnosis of several types of cancer.
605:
reduction in the surface expression of MMP-2. This result implies the use of chlorotoxin as a highly effective drug of therapeutic potential for diseases that involve the activity of MMP-2.
991:
Mamelak AN, Rosenfeld S, Bucholz R, et al. (August 2006). "Phase I single-dose study of intracavitary-administered iodine-131-TM-601 in adults with recurrent high-grade glioma".
831:
Lippens G, Najib J, Wodak SJ, Tartar A (January 1995). "NMR sequential assignments and solution structure of chlorotoxin, a small scorpion toxin that blocks chloride channels".
1142:
Fidel, J.; Kennedy, K. C.; Dernell, W. S.; Hansen, S.; Wiss, V.; Stroud, M. R.; Molho, J. I.; Knoblaugh, S. E.; Meganck, J.; Olson, J. M.; Rice, B.; Parrish-Novak, J. (2015).
459: 948:
Lyons SA, O'Neal J, Sontheimer H (August 2002). "Chlorotoxin, a scorpion-derived peptide, specifically binds to gliomas and tumors of neuroectodermal origin".
355: 1116: 624: 601:
chloride fluxes but this interaction does not happen for the neurons and normal glial cells. This suggests a potential treatment for cancer.
655:
suggests using a scorpion derived toxin to paint the pancreas and view it under infrared light to look for tumors too small to detect by
868:"Isolation and characterization of a novel lepidopteran-selective toxin from the venom of South Indian red scorpion, Mesobuthus tamulus" 1237: 1227: 633:
deficits, and postmortem studies revealed no evidence of neuropathy. In 2015, clinical trials were beginning for this "Tumor Paint."
568:
for Cl channels and it blocks small conductance chloride channels. Each chloride channel can be closed by only one ligand molecule.
330: 676: 1144:"Preclinical validation of the utility of BLZ-100 in providing fluorescence contrast for imaging canine spontaneous solid tumors" 273: 1232: 294: 704:
DeBin JA, Strichartz GR (1991). "Chloride channel inhibition by the venom of the scorpion Leiurus quinquestriatus".
466: 1222: 918: 793: 794:"Purification and characterization of chlorotoxin, a chloride channel ligand from the venom of the scorpion" 642: 521: 508:
cells has allowed the development of methods for the treatment and diagnosis of several types of cancer.
36: 612:
Phase II trials are being conducted on the use of chlorotoxin for imaging and radio therapy in glioma.
1120: 311: 183: 1191: 973: 1077:"Tumor paint: a chlorotoxin:Cy5.5 bioconjugate for intraoperative visualization of cancer foci" 1173: 1098: 1057: 1008: 965: 930: 899: 848: 813: 767: 721: 647: 549: 237: 1163: 1155: 1088: 1047: 1039: 1000: 957: 889: 879: 840: 805: 757: 713: 501: 378: 193: 282: 315: 1168: 1143: 1052: 1027: 545: 517: 437: 593:
Chlorotoxin has the ability to interact with chloride channels in membrane protein in
1216: 894: 867: 717: 652: 598: 262: 809: 977: 553: 493: 1159: 1093: 1076: 866:
Wudayagiri R, Inceoglu B, Herrmann R, Derbel M, Choudary PV, Hammock BD (2001).
623:, was used by researchers at Seattle Children's Hospital Research Institute and 616: 1043: 532:
Chlorotoxin is a small toxin and at pH 7 is highly positively charged. It is a
537: 482: 418: 228: 1004: 615:
Chlorotoxin:Cy5.5 (CTX:Cy5.5), which is a bioconjugate of chlorotoxin and a
1177: 1102: 1061: 1012: 969: 903: 884: 771: 762: 745: 934: 852: 817: 746:"Chlorotoxin inhibits glioma cell invasion via matrix metalloproteinase-2" 725: 629: 541: 844: 23: 961: 620: 533: 485: 249: 917:
Soroceanu L, Gillespie Y, Khazaeli MB, Sontheimer H (November 1998).
594: 565: 516:
Chlorotoxin can be purified from crude leiurus, which belongs to the
505: 436:
Except where otherwise noted, data are given for materials in their
163:-argininamide, cyclic (219),(528),(1633),(2035)-tetrakis(disulfide) 1026:
Mark R. Stroud; Stacey J. Hansen; James M. Olson (December 2011).
489: 216: 206: 656: 299: 1075:
Veiseh M, Gabikian P, Bahrami SB, et al. (July 2007).
919:"Use of chlorotoxin for targeting of primary brain tumors" 677:"Chlorotoxin from Leiurus quinquestriatus (north Africa)" 1028:"In Vivo Bio Imaging Using Chlorotoxin Based Conjugates" 564:
Chlorotoxin is the first reported high-affinity peptide
454: 1117:"Tumor Painting Revolutionizes Fight Against Cancer" 792:
DeBin JA, Maggio JE, Strichartz GR (February 1993).
744:
Deshane J, Garner CC, Sontheimer H (February 2003).
504:. The fact that chlorotoxin binds preferentially to 261: 192: 739: 737: 735: 787: 785: 783: 781: 699: 697: 8: 314: 236: 15: 1167: 1092: 1051: 893: 883: 761: 281: 668: 360: 335: 310: 625:Fred Hutchinson Cancer Research Center 342:Key: QPAKKWCQMHUHNI-GQIQPHNSSA-N 7: 171:MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR 252: 14: 548:. Chlorotoxin has a considerable 500:) which blocks small-conductance 444: 396: 390: 22: 810:10.1152/ajpcell.1993.264.2.C361 440:(at 25 °C , 100 kPa). 1119:. 15 July 2007. Archived from 408: 402: 384: 1: 1160:10.1158/0008-5472.CAN-15-0471 1094:10.1158/0008-5472.CAN-06-3948 1032:Current Pharmaceutical Design 718:10.1016/0041-0101(91)90128-E 1254: 1044:10.2174/138161211798999375 1238:Chloride channel blockers 1228:Experimental cancer drugs 1192:"Both Sides Now synopsis" 434: 371: 351: 326: 176: 168: 35: 30: 21: 1005:10.1200/JCO.2005.05.4569 597:cells, so this prevents 585:Possible therapeutic use 498:Leiurus quinquestriatus 119:-cysteinylglycylglycyl- 885:10.1186/1471-2091-2-16 763:10.1074/jbc.M205662200 552:to the class of small 494:deathstalker scorpion 845:10.1021/bi00001a003 645:" of medical drama 430: g·mol 18: 1233:Ion channel toxins 962:10.1002/glia.10083 804:(2 Pt 1): C361–9. 637:In popular culture 467:Infobox references 75:-.alpha.-aspartyl- 16: 1154:(20): 4283–4291. 550:sequence homology 536:consisting of 36 502:chloride channels 475:Chemical compound 473: 472: 295:CompTox Dashboard 218:Interactive image 162: 158: 154: 150: 146: 142: 138: 134: 130: 126: 122: 118: 114: 110: 106: 102: 98: 94: 90: 86: 82: 78: 74: 70: 66: 62: 58: 54: 50: 46: 42: 1245: 1207: 1206: 1204: 1202: 1188: 1182: 1181: 1171: 1139: 1133: 1132: 1130: 1128: 1113: 1107: 1106: 1096: 1072: 1066: 1065: 1055: 1023: 1017: 1016: 988: 982: 981: 945: 939: 938: 914: 908: 907: 897: 887: 863: 857: 856: 828: 822: 821: 789: 776: 775: 765: 741: 730: 729: 701: 692: 691: 689: 687: 681:Sigmaaldrich.com 673: 641:In the episode " 609:healthy tissue. 457: 451: 448: 447: 429: 427: 410: 404: 398: 392: 386: 379:Chemical formula 319: 318: 303: 301: 285: 265: 254: 240: 220: 196: 160: 156: 152: 148: 144: 140: 136: 132: 128: 124: 120: 116: 112: 108: 104: 100: 96: 92: 88: 84: 80: 76: 72: 68: 64: 60: 56: 52: 48: 44: 40: 26: 19: 1253: 1252: 1248: 1247: 1246: 1244: 1243: 1242: 1223:Scorpion toxins 1213: 1212: 1211: 1210: 1200: 1198: 1190: 1189: 1185: 1148:Cancer Research 1141: 1140: 1136: 1126: 1124: 1115: 1114: 1110: 1074: 1073: 1069: 1038:(38): 4362–71. 1025: 1024: 1020: 999:(22): 3644–50. 990: 989: 985: 947: 946: 942: 916: 915: 911: 865: 864: 860: 830: 829: 825: 791: 790: 779: 743: 742: 733: 703: 702: 695: 685: 683: 675: 674: 670: 665: 639: 587: 578: 562: 546:disulfide bonds 530: 514: 476: 469: 464: 463: 462:  ?) 453: 449: 445: 441: 425: 423: 413: 407: 401: 395: 389: 381: 367: 364: 359: 358: 347: 344: 343: 340: 334: 333: 322: 304: 297: 288: 268: 255: 243: 223: 210: 199: 186: 172: 164: 139:-tyrosylglycyl- 127:-arginylglycyl- 12: 11: 5: 1251: 1249: 1241: 1240: 1235: 1230: 1225: 1215: 1214: 1209: 1208: 1183: 1134: 1123:on 4 June 2016 1108: 1087:(14): 6882–8. 1067: 1018: 993:J. Clin. Oncol 983: 940: 929:(21): 4871–9. 909: 858: 823: 798:Am. J. Physiol 777: 756:(6): 4135–44. 731: 712:(11): 1403–8. 693: 667: 666: 664: 661: 643:Both Sides Now 638: 635: 586: 583: 577: 574: 561: 558: 529: 526: 518:scorpion toxin 513: 510: 474: 471: 470: 465: 443: 442: 438:standard state 435: 432: 431: 421: 415: 414: 411: 405: 399: 393: 387: 382: 377: 374: 373: 369: 368: 366: 365: 362: 354: 353: 352: 349: 348: 346: 345: 341: 338: 337: 329: 328: 327: 324: 323: 321: 320: 312:DTXSID70897247 307: 305: 293: 290: 289: 287: 286: 278: 276: 270: 269: 267: 266: 258: 256: 248: 245: 244: 242: 241: 233: 231: 225: 224: 222: 221: 213: 211: 204: 201: 200: 198: 197: 189: 187: 182: 179: 178: 174: 173: 170: 166: 165: 63:-phenylalanyl- 39: 33: 32: 28: 27: 13: 10: 9: 6: 4: 3: 2: 1250: 1239: 1236: 1234: 1231: 1229: 1226: 1224: 1221: 1220: 1218: 1197: 1193: 1187: 1184: 1179: 1175: 1170: 1165: 1161: 1157: 1153: 1149: 1145: 1138: 1135: 1122: 1118: 1112: 1109: 1104: 1100: 1095: 1090: 1086: 1082: 1078: 1071: 1068: 1063: 1059: 1054: 1049: 1045: 1041: 1037: 1033: 1029: 1022: 1019: 1014: 1010: 1006: 1002: 998: 994: 987: 984: 979: 975: 971: 967: 963: 959: 956:(2): 162–73. 955: 951: 944: 941: 936: 932: 928: 924: 920: 913: 910: 905: 901: 896: 891: 886: 881: 877: 873: 869: 862: 859: 854: 850: 846: 842: 838: 834: 827: 824: 819: 815: 811: 807: 803: 799: 795: 788: 786: 784: 782: 778: 773: 769: 764: 759: 755: 751: 750:J. Biol. Chem 747: 740: 738: 736: 732: 727: 723: 719: 715: 711: 707: 700: 698: 694: 682: 678: 672: 669: 662: 660: 658: 654: 650: 649: 644: 636: 634: 631: 626: 622: 618: 613: 610: 606: 602: 600: 599:transmembrane 596: 591: 584: 582: 575: 573: 569: 567: 559: 557: 555: 554:insectotoxins 551: 547: 543: 539: 535: 527: 525: 523: 519: 511: 509: 507: 503: 499: 495: 491: 488:found in the 487: 484: 480: 468: 461: 456: 439: 433: 422: 420: 417: 416: 383: 380: 376: 375: 370: 361: 357: 350: 336: 332: 325: 317: 313: 309: 308: 306: 296: 292: 291: 284: 280: 279: 277: 275: 272: 271: 264: 260: 259: 257: 251: 247: 246: 239: 235: 234: 232: 230: 227: 226: 219: 215: 214: 212: 208: 203: 202: 195: 191: 190: 188: 185: 181: 180: 175: 167: 123:-lysylglycyl- 38: 34: 29: 25: 20: 1199:. Retrieved 1195: 1186: 1151: 1147: 1137: 1127:11 September 1125:. Retrieved 1121:the original 1111: 1084: 1080: 1070: 1035: 1031: 1021: 996: 992: 986: 953: 949: 943: 926: 922: 912: 875: 871: 861: 839:(1): 13–21. 836: 833:Biochemistry 832: 826: 801: 797: 753: 749: 709: 705: 686:November 30, 684:. Retrieved 680: 671: 646: 640: 614: 611: 607: 603: 592: 588: 579: 570: 563: 531: 515: 497: 478: 477: 177:Identifiers 169:Other names 147:-glutaminyl- 111:-α-aspartyl- 107:-α-aspartyl- 83:-glutaminyl- 17:Chlorotoxin 1201:30 November 872:BMC Biochem 617:fluorescent 538:amino acids 522:superfamily 479:Chlorotoxin 372:Properties 194:163515-35-3 159:-cysteinyl- 151:-cysteinyl- 135:-cysteinyl- 115:-cysteinyl- 103:-cysteinyl- 87:-methionyl- 59:-cysteinyl- 51:-methionyl- 47:-cysteinyl- 43:-methionyl- 1217:Categories 1081:Cancer Res 923:Cancer Res 663:References 619:dye named 544:forming 4 483:amino acid 419:Molar mass 283:06UV5RFW57 229:ChemSpider 205:3D model ( 184:CAS Number 79:-histidyl- 71:-threonyl- 67:-threonyl- 37:IUPAC name 542:cysteines 540:, with 8 528:Chemistry 95:-arginyl- 1196:IMDb.com 1178:26471914 1103:17638899 1062:22204434 1013:16877732 970:12112367 904:11782289 772:12454020 630:infrared 576:Toxicity 520:protein 481:is a 36- 263:86278273 238:57582614 155:-leucyl- 143:-prolyl- 91:-alanyl- 55:-prolyl- 1169:4610180 1053:3272502 978:8513870 935:9809993 853:7819188 818:8383429 726:1726031 706:Toxicon 534:peptide 512:Sources 492:of the 486:peptide 460:what is 458: ( 250:PubChem 131:-lysyl- 99:-lysyl- 1176:  1166:  1101:  1060:  1050:  1011:  976:  968:  933:  902:  892:  878:: 16. 851:  816:  770:  724:  595:glioma 566:ligand 560:Target 506:glioma 455:verify 452:  356:SMILES 31:Names 974:S2CID 895:64496 653:House 648:House 621:Cy5.5 490:venom 331:InChI 207:JSmol 1203:2015 1174:PMID 1129:2015 1099:PMID 1058:PMID 1009:PMID 966:PMID 950:Glia 931:PMID 900:PMID 849:PMID 814:PMID 768:PMID 722:PMID 688:2021 274:UNII 1164:PMC 1156:doi 1089:doi 1048:PMC 1040:doi 1001:doi 958:doi 890:PMC 880:doi 841:doi 806:doi 802:264 758:doi 754:278 714:doi 657:MRI 428:.71 426:995 394:249 388:158 300:EPA 253:CID 1219:: 1194:. 1172:. 1162:. 1152:75 1150:. 1146:. 1097:. 1085:67 1083:. 1079:. 1056:. 1046:. 1036:17 1034:. 1030:. 1007:. 997:24 995:. 972:. 964:. 954:39 952:. 927:58 925:. 921:. 898:. 888:. 874:. 870:. 847:. 837:34 835:. 812:. 800:. 796:. 780:^ 766:. 752:. 748:. 734:^ 720:. 710:29 708:. 696:^ 679:. 659:. 651:, 556:. 524:. 412:11 406:47 400:53 1205:. 1180:. 1158:: 1131:. 1105:. 1091:: 1064:. 1042:: 1015:. 1003:: 980:. 960:: 937:. 906:. 882:: 876:2 855:. 843:: 820:. 808:: 774:. 760:: 728:. 716:: 690:. 496:( 450:N 424:3 409:S 403:O 397:N 391:H 385:C 302:) 298:( 209:) 161:L 157:L 153:L 149:L 145:L 141:L 137:L 133:L 129:L 125:L 121:L 117:L 113:L 109:L 105:L 101:L 97:L 93:L 89:L 85:L 81:L 77:L 73:L 69:L 65:L 61:L 57:L 53:L 49:L 45:L 41:L

Index


IUPAC name
CAS Number
163515-35-3
JSmol
Interactive image
ChemSpider
57582614
PubChem
86278273
UNII
06UV5RFW57
CompTox Dashboard
DTXSID70897247
Edit this at Wikidata
InChI
SMILES
Chemical formula
Molar mass
standard state
verify
what is
Infobox references
amino acid
peptide
venom
deathstalker scorpion
chloride channels
glioma
scorpion toxin

Text is available under the Creative Commons Attribution-ShareAlike License. Additional terms may apply.