Knowledge (XXG)

Homeobox

Source 📝

876: 766: 1121: 42: 1102:. It is accepted that the three major animal ANTP-class clusters, Hox, ParaHox, and NK (MetaHox), are the result of segmental duplications. A first duplication created MetaHox and ProtoHox, the latter of which later duplicated into Hox and ParaHox. The clusters themselves were created by tandem duplications of a single ANTP-class homeobox gene. Gene duplication followed by 1217:
LIM genes (named after the initial letters of the names of three proteins where the characteristic domain was first identified) encode two 60 amino acid cysteine and histidine-rich LIM domains and a homeodomain. The LIM domains function in protein-protein interactions and can bind zinc molecules. LIM
983:
residues in the center of the recognition helix aid in stabilizing the helix packing. Homeodomain proteins show a preference for the DNA sequence 5'-TAAT-3'; sequence-independent binding occurs with significantly lower affinity. The specificity of a single homeodomain protein is usually not enough to
1152:
and colleagues in 1984. The main interest in this set of genes stems from their unique behavior and arrangement in the genome. Hox genes are typically found in an organized cluster. The linear order of Hox genes within a cluster is directly correlated to the order they are expressed in both time and
1040:
are highly conserved developmental master regulators with tight tissue-specific, spatiotemporal control. These genes are known to be dysregulated in several cancers and are often controlled by DNA methylation. The regulation of Hox genes is highly complex and involves reciprocal interactions, mostly
1297:
As in animals, the plant homeobox genes code for the typical 60 amino acid long DNA-binding homeodomain or in case of the TALE (three amino acid loop extension) homeobox genes for an atypical homeodomain consisting of 63 amino acids. According to their conserved intron–exon structure and to unique
1197:
cell (EC) migration by upregulating MMP14 and uPAR. Conversely, HoxD10 and HoxA5 have the opposite effect of suppressing EC migration and angiogenesis, and stabilizing adherens junctions by upregulating TIMP1/downregulating uPAR and MMP14, and by upregulating Tsp2/downregulating VEGFR2, Efna1,
1202:
growth. HoxA5 has far-reaching effects on gene expression, causing ~300 genes to become upregulated upon its induction in breast cancer cell lines. HoxA5 protein transduction domain overexpression prevents inflammation shown by inhibition of TNFalpha-inducible monocyte binding to HUVECs.
1000:
due to the DNA binding properties of the conserved HTH motif. Homeodomain proteins are considered to be master control genes, meaning that a single protein can regulate expression of many target genes. Homeodomain proteins direct the formation of the body axes and body structures during
984:
recognize specific target gene promoters, making cofactor binding an important mechanism for controlling binding sequence specificity and target gene expression. To achieve higher target specificity, homeodomain proteins form complexes with other transcription factors to recognize the
871:
Helix 1 Helix 2 Helix 3/4 ______________ __________ _________________ RRRKRTAYTRYQLLELEKEFHFNRYLTRRRRIELAHSLNLTERHIKIWFQNRRMKWKKEN ....|....|....|....|....|....|....|....|....|....|....|....| 10 20 30 40 50
1193:, and disease by orchestrating changes in matrix degradation, integrins, and components of the ECM. HoxA5 is implicated in atherosclerosis. HoxD3 and HoxB3 are proinvasive, angiogenic genes that upregulate b3 and a5 integrins and Efna1 in ECs, respectively. HoxA3 induces 1089:
Phylogenetic analysis of homeobox gene sequences and homeodomain protein structures suggests that the last common ancestor of plants, fungi, and animals had at least two homeobox genes. Molecular evidence shows that some limited number of Hox genes have existed in the
1298:
codomain architectures they have been grouped into 14 distinct classes: HD-ZIP I to IV, BEL, KNOX, PLINC, WOX, PHD, DDT, NDX, LD, SAWADEE and PINTOX. Conservation of codomains suggests a common eukaryotic ancestry for TALE and non-TALE homeodomain proteins.
1275:
motifs and also binds DNA. The two domains are linked by a flexible loop that is long enough to stretch around the DNA helix, allowing the two domains to bind on opposite sides of the target DNA, collectively covering an eight-base segment with
4981: 1280:
5'-ATGCAAAT-3'. The individual domains of POU proteins bind DNA only weakly, but have strong sequence-specific affinity when linked. The POU domain itself has significant structural similarity with repressors expressed in
963:
with the C-terminal recognition helix aligning in the DNA's major groove and the unstructured peptide "tail" at the N-terminus aligning in the minor groove. The recognition helix and the inter-helix loops are rich in
723:
to regulate expression of target genes. Homeodomain proteins regulate gene expression and cell differentiation during early embryonic development, thus mutations in homeobox genes can cause developmental disorders.
1106:
is responsible for the many homeobox genes found in eukaryotes. Comparison of homeobox genes and gene clusters has been used to understand the evolution of genome structure and body morphology throughout metazoans.
950:
interference of the beta-carbon with the main chain: for cro and repressor proteins the glycine appears to be mandatory, whereas for many of the homeotic and other DNA-binding proteins the requirement is relaxed.
1164:. For example, when one gene is lost the segment develops into a more anterior one, while a mutation that leads to a gain of function causes a segment to develop into a more posterior one. Famous examples are 1232:
Most Pax genes contain a homeobox and a paired domain that also binds DNA to increase binding specificity, though some Pax genes have lost all or part of the homeobox sequence. Pax genes function in embryo
4974: 3686:
Carrasco AE, McGinnis W, Gehring WJ, De Robertis EM (June 1984). "Cloning of an X. laevis gene expressed during early embryogenesis coding for a peptide region homologous to Drosophila homeotic genes".
2970:
Carrasco AE, McGinnis W, Gehring WJ, De Robertis EM (June 1984). "Cloning of an X. laevis gene expressed during early embryogenesis coding for a peptide region homologous to Drosophila homeotic genes".
879:
The vnd/NK-2 homeodomain-DNA complex. Helix 3 of the homeodomain binds in the major groove of the DNA and the N-terminal arm binds in the minor groove, in analogy with other homeodomain-DNA complexes.
1218:
domain proteins are found in both the cytosol and the nucleus. They function in cytoskeletal remodeling, at focal adhesion sites, as scaffolds for protein complexes, and as transcription factors.
677:
long, that regulates large-scale anatomical features in the early stages of embryonic development. Mutations in a homeobox may change large-scale anatomical features of the full-grown organism.
2509:
Billeter M, Qian YQ, Otting G, Müller M, Gehring W, Wüthrich K (December 1993). "Determination of the nuclear magnetic resonance solution structure of an Antennapedia homeodomain-DNA complex".
5903: 10393: 4967: 6402: 2699:
Materials for the study of variation, treated with especial regard to discontinuity in the origin of species William Bateson 1861–1926. London : Macmillan 1894 xv, 598 p
8609: 3781:
Fromental-Ramain C, Warot X, Messadecq N, LeMeur M, Dollé P, Chambon P (October 1996). "Hoxa-13 and Hoxd-13 play a crucial role in the patterning of the limb autopod".
1198:
Hif1alpha and COX-2, respectively. HoxA5 also upregulates the tumor suppressor p53 and Akt1 by downregulation of PTEN. Suppression of HoxA5 has been shown to attenuate
796:
revealed that this gene contained a 180 base pair sequence that encoded a DNA binding domain, which William McGinnis termed the "homeobox". The existence of additional
786:
by isolating the gene responsible for a homeotic transformation where legs grow from the head instead of the expected antennae. Walter Gehring identified a gene called
7287: 6309: 6304: 6299: 192: 5948: 2860:
McGinnis W, Levine MS, Hafen E, Kuroiwa A, Gehring WJ (1984). "A conserved DNA sequence in homoeotic genes of the Drosophila Antennapedia and bithorax complexes".
5933: 5619: 2913:"Structural relationships among genes that control development: sequence homology between the Antennapedia, Ultrabithorax, and fushi tarazu loci of Drosophila" 1185:
clusters are partially redundant in function, but have also acquired several derived functions. For example, HoxA and HoxD specify segment identity along the
942:, homeodomain proteins, etc.). One of the principal differences between HTH motifs in these different proteins arises from the stereochemical requirement for 6442: 10959: 10237: 10221: 5040: 6294: 6079: 6072: 6067: 6055: 6050: 6045: 6040: 6035: 5963: 116: 9959: 4268:
Rhoads K, Arderiu G, Charboneau A, Hansen SL, Hoffman W, Boudreau N (2005). "A role for Hox A5 in regulating angiogenesis and vascular patterning".
6758: 1053:
complexes to maintain the expression of Hox genes after the down-regulation of the pair-rule and gap genes that occurs during larval development.
907:
via a number of hydrogen bonds and hydrophobic interactions, as well as indirect interactions via water molecules, which occur between specific
738:—replacement of the antenna on the head of a fruit fly with legs. The "homeo-" prefix in the words "homeobox" and "homeodomain" stems from this 10915: 5817: 3730:
Schneuwly S, Klemenz R, Gehring WJ (1987). "Redesigning the body plan of Drosophila by ectopic expression of the homoeotic gene Antennapedia".
1253:
is a master regulator of eye development, such that the gene is necessary for development of the optic vesicle and subsequent eye structures.
4863: 4836: 3287: 140: 4583:"Analysis of TALE superclass homeobox genes (MEIS, PBC, KNOX, Iroquois, TGIF) reveals a novel domain conserved between plants and animals" 3101: 2839: 1142:
genes that determine the identity of embryonic regions along the anterior-posterior axis. The first vertebrate Hox gene was isolated in
926:. Through the HTH motif, they share limited sequence similarity and structural similarity to prokaryotic transcription factors, such as 10880: 9722: 5614: 5186: 10453: 10725: 9991: 8890: 6977: 2475: 4525: 3051: 10425: 6435: 6430: 6358: 6348: 5225: 5215: 5050: 1641:
Human TALE (Three Amino acid Loop Extension) homeobox genes for an "atypical" homeodomain consist of 63 rather than 60 amino acids:
10468: 10463: 4630:
Derelle R, Lopez P, Le Guyader H, Manuel M (2007). "Homeodomain proteins belong to the ancestral molecular toolkit of eukaryotes".
1638:. Dlx genes are involved in the development of the nervous system and of limbs. They are considered a subset of the NK-like genes. 2671: 10682: 6353: 6267: 4926: 3080: 1607:. The NK-like (NKL) genes, some of which are considered "MetaHox", are grouped with Hox-like genes into a large ANTP-like group. 829: 10939: 9289: 6565: 6555: 5156: 5035: 4754: 1077:. Duplication of homeobox genes can produce new body segments, and such duplications are likely to have been important in the 10949: 6920: 6560: 6255: 2297: 903:
helix is roughly perpendicular to the axes established by the first two. It is this third helix that interacts directly with
844:
studies detailing the evolutionary relationship between homeobox-containing genes showed that these genes are present in all
10859: 212: 10710: 10202: 10197: 9348: 6260: 10297: 8633: 6783: 6336: 6326: 1178:, which can cause the development of legs instead of antennae and the development of a duplicated thorax, respectively. 10677: 8802: 8797: 8348: 6425: 6343: 6331: 5407: 2199: 2015: 934:. The HTH motif shows some sequence similarity but a similar structure in a wide range of DNA-binding proteins (e.g., 896: 4049:"The homeobox transcription factor Hox D3 promotes integrin alpha5beta1 expression and function during angiogenesis" 10869: 10735: 10567: 6538: 5536: 3383:"Pre-bilaterian origins of the Hox cluster and the Hox code: evidence from the sea anemone, Nematostella vectensis" 805: 10562: 9954: 6835: 6820: 6803: 6798: 6793: 6788: 6699: 6674: 6550: 6462: 6452: 5609: 5082: 3293: 3229:
Bhatlekar S, Fields JZ, Boman BM (August 2014). "HOX genes and their role in the development of human cancers".
10944: 9696: 9331: 8847: 8420: 8259: 7194: 7189: 7174: 6649: 6624: 6506: 6457: 6250: 5641: 5107: 4939: 1050: 1006: 840:
and William McGinnis revealed that numerous genes from a variety of species contained the homeobox. Subsequent
4357:"Restoring transcription factor HoxA5 expression inhibits the growth of experimental hemangiomas in the brain" 200: 3274:"The Role of RNAi and Noncoding RNAs in Polycomb Mediated Control of Gene Expression and Genomic Programming" 10954: 10803: 10740: 10715: 10598: 10518: 10061: 8102: 7419: 6533: 6521: 2241: 1268: 1054: 1046: 977: 52: 4776:
Kraus P, Lufkin T (July 2006). "Dlx homeobox gene control of mammalian limb and craniofacial development".
4546:
Walther C, Gruss P (December 1991). "Pax-6, a murine paired box gene, is expressed in the developing CNS".
3016:"A homologous protein-coding sequence in Drosophila homeotic genes and its conservation in other metazoans" 10788: 10687: 10672: 10641: 10542: 10192: 8239: 8234: 6629: 6526: 6321: 6282: 5345: 4994: 4917: 4229:"HOXA3 induces cell migration in endothelial and epithelial cells promoting angiogenesis and wound repair" 2293: 1234: 1018: 60:. The recognition helix and unstructured N-terminus are bound in the major and minor grooves respectively. 10899: 10793: 10720: 10619: 10557: 10552: 10483: 10418: 10184: 9744: 6543: 6479: 6474: 6287: 5363: 1149: 837: 670: 121: 3580:"Evolution of Homeobox Gene Clusters in Animals: The Giga-Cluster and Primary vs. Secondary Clustering" 196: 776:
mutant phenotype exhibit homeotic transformation of the antennae into leg-like structures on the head.
10808: 10651: 10646: 10528: 10523: 10510: 9765: 9757: 7595: 7077: 6602: 6597: 6592: 6272: 6155: 4990: 4742: 3739: 3642: 3394: 3327: 2924: 2869: 1339: 1103: 997: 833: 813: 712: 153: 4959: 875: 10904: 10079: 9783: 9479: 7682: 6887: 6469: 6447: 6420: 6382: 6316: 4855: 817: 4910:
The Homeodomain Resource (National Human Genome Research Institute, National Institutes of Health)
3131:
Corsetti MT, Briata P, Sanseverino L, Daga A, Airoldi I, Simeone A, et al. (September 1992).
753:
and segmentation proteins, but is now known to be well-conserved in many other animals, including
10593: 9617: 4801: 4655: 4517: 4470: 4445:
Kadrmas JL, Beckerle MC (November 2004). "The LIM domain: from the cytoskeleton to the nucleus".
3841: 3763: 3712: 3668: 3560: 3465: 3345: 3254: 3043: 2996: 2893: 2729: 1564: 1277: 1242: 1182: 1161: 985: 865: 2099: 1779: 3109: 2747:
Scott MP, Tamkun JW, Hartzell GW (July 1989). "The structure and function of the homeodomain".
10854: 10838: 10634: 10629: 10538: 9199: 9190: 8827: 7775: 6516: 6511: 4890: 4859: 4832: 4793: 4758: 4715: 4647: 4612: 4563: 4509: 4462: 4427: 4386: 4337: 4285: 4250: 4209: 4160: 4119: 4070: 4029: 3980: 3931: 3902:"Flow-Dependent Epigenetic DNA Methylation in Endothelial Gene Expression and Atherosclerosis" 3882: 3833: 3798: 3755: 3704: 3660: 3611: 3552: 3517: 3457: 3422: 3381:
Ryan JF, Mazza ME, Pang K, Matus DQ, Baxevanis AD, Martindale MQ, et al. (January 2007).
3363: 3283: 3246: 3211: 3182:"Flow-Dependent Epigenetic DNA Methylation in Endothelial Gene Expression and Atherosclerosis" 3162: 3035: 2988: 2952: 2885: 2831: 2813: 2764: 2653: 2618: 2580: 2526: 2499: 1835: 1831: 1501: 1449: 1393: 1333: 1010: 939: 219: 187: 9010: 9005: 9000: 8995: 8990: 4915:
HomeoDB: a database of homeobox genes diversity. Zhong YF, Butts T, Holland PWH, since 2008.
2191: 1925: 1921: 1718: 1714: 1073:
changes in body segment identity, such as the Antennapedia and Bithorax mutant phenotypes in
10864: 10833: 10828: 10783: 10411: 8082: 7726: 7708: 6277: 6224: 5998: 4882: 4847: 4785: 4750: 4705: 4695: 4639: 4602: 4594: 4555: 4501: 4454: 4417: 4376: 4368: 4327: 4319: 4277: 4240: 4199: 4191: 4150: 4109: 4101: 4060: 4019: 4011: 3970: 3962: 3921: 3913: 3872: 3825: 3790: 3747: 3696: 3650: 3601: 3591: 3544: 3507: 3499: 3449: 3412: 3402: 3353: 3335: 3238: 3201: 3193: 3152: 3144: 3027: 2980: 2942: 2932: 2877: 2803: 2795: 2756: 2721: 2645: 2610: 2570: 2562: 2518: 2396: 2372: 2352: 2344: 2225: 1847: 1843: 1839: 1791: 1272: 1171: 884: 825: 809: 9170: 9165: 9115: 9105: 9085: 9070: 9050: 8975: 8955: 8097: 8092: 3951:"The role of epigenetics in the endothelial cell shear stress response and atherosclerosis" 3440:
Garcia-Fernàndez J (December 2005). "The genesis and evolution of homeobox gene clusters".
2333: 2317: 2237: 2233: 2207: 2195: 2087: 2055: 2019: 2011: 1992: 1984: 1960: 1952: 1869: 1865: 1861: 1857: 1674: 179: 10874: 10778: 10588: 9867: 9090: 8960: 8326: 8284: 8279: 8274: 8212: 8124: 8046: 7834: 7785: 7780: 5827: 4921: 4489: 3316:"Did homeodomain proteins duplicate before the origin of angiosperms, fungi, and metazoa?" 3015: 2384: 2380: 2376: 2329: 2281: 2211: 2179: 2071: 2059: 2047: 2043: 2039: 2035: 2031: 2027: 2023: 1933: 1911: 1765: 1761: 1753: 1733: 1694: 1611: 1588: 1584: 1572: 1568: 1014: 734:
to describe the outright replacement of a discrete body part with another body part, e.g.
731: 4848: 4733:
Coulier F, Popovici C, Villet R, Birnbaum D (15 December 2000). "MetaHox gene clusters".
4137:
Chen Y, Xu B, Arderiu G, Hashimoto T, Young WL, Boudreau N, et al. (November 2004).
4746: 3743: 3646: 3398: 3331: 2928: 2873: 10934: 9964: 8244: 8227: 6370: 6025: 5022: 4710: 4683: 4381: 4356: 4332: 4307: 4204: 4179: 4155: 4138: 4114: 4089: 4024: 3999: 3975: 3950: 3926: 3901: 3512: 3487: 3417: 3382: 3206: 3181: 2799: 2679: 2575: 2550: 2340: 1238: 1186: 4873:
Ogishima S, Tanaka H (January 2007). "Missing link in the evolution of Hox clusters".
4607: 4582: 4195: 3655: 3630: 3157: 3132: 3073: 2947: 2912: 2808: 2783: 1189:
axis. Specific members of the Hox family have been implicated in vascular remodeling,
765: 10928: 10842: 10756: 10624: 10458: 10435: 8822: 8162: 6587: 6375: 5703: 4825: 4643: 4505: 3700: 3358: 3315: 3031: 2984: 2760: 2725: 2712:
Schofield PN (1987). "Patterns, puzzles and paradigms - The riddle of the homeobox".
2649: 2614: 1455: 1399: 1282: 1157: 1002: 973: 841: 685: 145: 4935: 4930: 4823:
Lodish H, Berk A, Matsudaira P, Kaiser CA, Krieger M, Scott MP, et al. (2003).
4805: 4521: 3716: 3672: 3564: 3469: 3258: 3047: 3000: 2733: 84: 41: 10667: 10488: 10478: 10372: 9684: 9567: 9559: 8930: 8886: 7889: 7737: 4659: 4474: 3845: 3767: 2897: 1507: 1286: 1190: 1166: 1138:
Hox genes are the most commonly known subset of homeobox genes. They are essential
1022: 935: 927: 916: 857: 788: 735: 716: 175: 47: 17: 3816:
Zákány J, Duboule D (April 1999). "Hox genes in digit development and evolution".
3488:"A comprehensive classification and evolutionary analysis of plant homeobox genes" 1120: 97: 4955: 4372: 4355:
Zhu Y, Cuevas IC, Gabriel RA, Su H, Nishimura S, Gao P, et al. (June 2009).
3966: 3407: 1160:
cause displacement of body segments during embryonic development. This is called
109: 10603: 10583: 10056: 9659: 8139: 7854: 7819: 6208: 6013: 6008: 5451: 5255: 5250: 5146: 5026: 2289: 1948: 1929: 1623: 1344: 1194: 980: 888: 821: 10403: 4886: 4139:"Retroviral delivery of homeobox D3 gene induces cerebral angiogenesis in mice" 3917: 3320:
Proceedings of the National Academy of Sciences of the United States of America
3197: 2917:
Proceedings of the National Academy of Sciences of the United States of America
1009:
by initiating the cascades of coregulated genes required to produce individual
10847: 10547: 10500: 10368: 10319: 9791: 9395: 9304: 9284: 9257: 8604: 8353: 8202: 8190: 8185: 7184: 7179: 5943: 5938: 5916: 5782: 5600: 5304: 5245: 5240: 5220: 4404:
Chen H, Rubin E, Zhang H, Chung S, Jie CC, Garrett E, et al. (May 2005).
3242: 2566: 2273: 2265: 2261: 2175: 2111: 2067: 1318: 1262: 1212: 1199: 1042: 931: 912: 908: 900: 892: 861: 782: 754: 4909: 4598: 3877: 3860: 3615: 3340: 3148: 10798: 10766: 10533: 10439: 10242: 10232: 10215: 9689: 8708: 6413: 5842: 5500: 3794: 3596: 3579: 3503: 2937: 2480: 2441: 1227: 1099: 1095: 1078: 1070: 1058: 923: 845: 701: 674: 4894: 4797: 4762: 4719: 4700: 4651: 4559: 4466: 4431: 4422: 4405: 4390: 4341: 4289: 4281: 4254: 4213: 4164: 4123: 4074: 4065: 4048: 3984: 3935: 3886: 3837: 3664: 3556: 3521: 3461: 3426: 3250: 3215: 2584: 2522: 684:
that are involved in the regulation of patterns of anatomical development (
4616: 4567: 4513: 4105: 4033: 4015: 3829: 3802: 3759: 3708: 3367: 3166: 3039: 2992: 2956: 2889: 2817: 2784:"Genomic and cDNA clones of the homeotic locus Antennapedia in Drosophila" 2768: 2657: 2622: 2530: 1267:
Proteins containing a POU region consist of a homeodomain and a separate,
149: 10761: 9709: 9487: 6408: 6365: 5417: 4951: 4789: 4323: 3998:
Boudreau N, Andrews C, Srebrow A, Ravanpay A, Cheresh DA (October 1997).
3133:"Differential DNA binding properties of three human homeodomain proteins" 1246: 1133: 1091: 1037: 1033: 965: 750: 739: 727: 104: 10493: 10109: 10089: 10084: 9796: 7770: 7554: 5466: 5461: 5456: 5444: 5439: 3631:"Hox proteins: sculpting body parts by activating localized cell death" 3279:
RNA and the Regulation of Gene Expression: A Hidden Layer of Complexity
1917: 1552: 1144: 1139: 943: 743: 708: 133: 128: 4245: 4228: 4178:
Myers C, Charboneau A, Cheung I, Hanks D, Boudreau N (December 2002).
3606: 2503: 651: 645: 639: 633: 627: 621: 615: 609: 603: 597: 591: 585: 579: 573: 567: 561: 555: 549: 543: 537: 531: 525: 519: 513: 507: 501: 495: 489: 483: 477: 471: 465: 459: 453: 447: 441: 435: 429: 423: 417: 411: 405: 399: 393: 387: 381: 375: 369: 363: 357: 351: 345: 339: 333: 327: 321: 315: 309: 303: 297: 291: 285: 279: 273: 267: 261: 255: 249: 243: 237: 231: 225: 10473: 10290: 10285: 10280: 10270: 10265: 9984: 9539: 9534: 9529: 9524: 8790: 8785: 8662: 8657: 8652: 8637: 8628: 8623: 8618: 8597: 8511: 8506: 8294: 8289: 8269: 8264: 8254: 8249: 8087: 8039: 8034: 8029: 8024: 7994: 7989: 7984: 7979: 7949: 7899: 7894: 7657: 7577: 7549: 7544: 7539: 7534: 7529: 7524: 7519: 7514: 7509: 7504: 7499: 7494: 7489: 7484: 7479: 7474: 7469: 7464: 7454: 7449: 7444: 7439: 7434: 7429: 7424: 7414: 7409: 7404: 7364: 7317: 7312: 7307: 7302: 7297: 7292: 7282: 7270: 7265: 7031: 7026: 7021: 6903: 6898: 6870: 6865: 6850: 6845: 6840: 6830: 6825: 6813: 6808: 6180: 6175: 6170: 6165: 6160: 6135: 6062: 6030: 5973: 5968: 5755: 5750: 5745: 5629: 5434: 5324: 5319: 5292: 5287: 5282: 5208: 4755:
10.1002/1097-010X(20001215)288:4<345::AID-JEZ7>3.0.CO;2-Y
3751: 3349: 3277: 3273: 2881: 2392: 2388: 2368: 2364: 2360: 2356: 2348: 2229: 2187: 2183: 2147: 2143: 1876: 1827: 1823: 1819: 1815: 1811: 1807: 1803: 1799: 1795: 1787: 1783: 1702: 1698: 1544: 1540: 1536: 1532: 1492: 1488: 1484: 1480: 1440: 1384: 1380: 1376: 969: 947: 864:
long domain composed of three alpha helixes. The following shows the
693: 689: 207: 4458: 3861:"The role of homeobox genes in vascular remodeling and angiogenesis" 3548: 3453: 2832:"Walter Jakob Gehring (1939-2014) | The Embryo Project Encyclopedia" 1724:
In addition, humans have the following homeobox genes and proteins:
1306:
The Hox genes in humans are organized in four chromosomal clusters:
4306:
Arderiu G, Cuevas I, Chen A, Carrio M, East L, Boudreau NJ (2007).
10334: 10312: 10307: 10275: 10164: 10159: 10104: 10099: 10094: 10038: 9947: 9942: 9937: 9932: 9927: 9922: 9917: 9912: 9860: 9855: 9843: 9838: 9833: 9828: 9816: 9811: 9806: 9801: 9770: 9737: 9732: 9727: 9674: 9669: 9664: 9639: 9597: 9592: 9587: 9582: 9577: 9572: 9544: 9497: 9492: 9438: 9433: 9428: 9423: 9400: 9175: 9160: 9155: 9150: 9145: 9140: 9135: 9130: 9125: 9120: 9110: 9100: 9095: 9080: 9075: 9065: 9060: 9055: 9045: 9040: 9035: 9030: 9025: 9020: 9015: 8985: 8980: 8970: 8965: 8950: 8945: 8940: 8935: 8869: 8864: 8859: 8832: 8807: 8775: 8768: 8763: 8669: 8647: 8642: 8614: 8592: 8587: 8582: 8577: 8472: 8467: 8412: 8405: 8400: 8385: 8358: 8019: 8014: 8009: 8004: 7999: 7974: 7969: 7964: 7959: 7954: 7944: 7939: 7934: 7929: 7924: 7919: 7914: 7909: 7904: 7884: 7879: 7874: 7869: 7864: 7859: 7844: 7839: 7664: 7652: 7647: 7642: 7637: 7605: 7600: 7399: 7389: 7384: 7379: 7374: 7369: 7359: 7354: 7349: 7344: 7260: 7250: 7243: 7238: 7233: 7228: 7218: 7162: 7157: 7152: 7147: 7142: 7137: 7132: 7053: 7048: 7043: 6987: 6982: 6881: 6860: 6855: 6729: 6724: 6719: 6714: 6709: 6704: 5911: 5676: 5671: 5666: 5656: 5651: 5646: 5636: 5624: 5574: 5554: 5495: 5483: 5478: 5402: 5395: 5390: 5380: 5373: 5368: 5299: 5230: 5203: 5198: 5181: 5176: 5171: 5166: 5161: 5151: 5139: 5134: 5112: 5102: 5097: 5087: 3014:
McGinnis W, Garber RL, Wirz J, Kuroiwa A, Gehring WJ (June 1984).
2321: 2313: 2203: 2171: 2167: 2163: 2159: 2155: 2151: 2095: 2091: 2075: 1980: 1976: 1964: 1956: 1941: 1937: 1853: 1773: 1769: 1710: 1706: 1670: 1666: 1600: 1596: 1528: 1524: 1520: 1516: 1512: 1476: 1472: 1468: 1464: 1460: 1436: 1432: 1428: 1424: 1420: 1416: 1412: 1408: 1404: 1372: 1368: 1364: 1360: 1356: 1352: 1348: 1153:
space during development. This phenomenon is called colinearity.
1119: 960: 874: 764: 697: 10771: 10361: 10356: 10351: 10341: 10329: 10324: 10171: 10154: 10018: 10013: 10008: 9979: 9974: 9907: 9902: 9897: 9892: 9887: 9882: 9877: 9872: 9823: 9717: 9679: 9654: 9649: 9644: 9627: 9519: 9512: 9507: 9388: 9383: 9378: 9373: 9368: 9363: 9358: 9353: 9343: 9336: 9326: 9321: 9309: 9299: 9294: 9277: 9272: 9267: 9250: 9245: 9240: 9215: 9210: 9205: 8923: 8918: 8913: 8908: 8903: 8842: 8817: 8812: 8753: 8748: 8743: 8738: 8733: 8728: 8723: 8718: 8713: 8684: 8679: 8572: 8567: 8562: 8557: 8543: 8538: 8533: 8528: 8523: 8494: 8489: 8484: 8450: 8445: 8440: 8435: 8430: 8425: 8390: 8378: 8373: 8368: 8321: 8316: 8311: 8306: 8301: 8222: 8207: 8197: 8173: 8168: 8154: 8149: 8144: 8134: 8129: 8117: 8112: 8056: 8051: 7829: 7814: 7809: 7797: 7792: 7625: 7620: 7615: 7459: 7394: 7339: 7334: 7329: 7213: 7208: 7203: 7127: 7122: 7117: 7112: 7107: 7102: 7097: 7092: 7087: 7070: 7065: 7009: 7004: 6972: 6967: 6962: 6952: 6947: 6940: 6935: 6930: 6925: 6915: 6910: 6893: 6751: 6746: 6741: 6669: 6130: 6125: 6120: 6115: 6110: 6105: 6018: 6003: 5980: 5953: 5926: 5921: 5886: 5864: 5859: 5854: 5837: 5832: 5822: 5812: 5762: 5720: 5715: 5698: 5693: 5688: 5586: 5581: 5569: 5527: 5522: 5512: 5427: 5422: 5412: 5331: 5314: 5277: 5265: 5260: 5235: 5193: 5122: 5117: 5092: 5075: 5070: 5065: 5060: 5055: 5045: 4947: 2325: 2309: 2305: 2301: 2285: 2277: 2269: 2257: 2253: 2249: 2245: 2219: 2215: 2139: 2135: 2131: 2127: 2123: 2119: 2115: 2107: 2103: 2079: 2063: 2051: 2007: 2003: 1999: 1988: 1972: 1968: 1907: 1903: 1899: 1895: 1891: 1884: 1880: 1757: 1749: 1745: 1741: 1737: 1729: 1690: 1686: 1682: 1662: 1658: 1654: 1650: 1646: 1642: 1635: 1631: 1627: 1619: 1615: 1604: 1592: 1580: 1576: 1560: 1556: 1250: 681: 169: 91: 79: 10407: 10132: 9461: 7703: 6203: 5005: 4963: 4914: 4227:
Mace KA, Hansen SL, Myers C, Young DM, Boudreau N (June 2005).
4090:"Homeobox B3 promotes capillary morphogenesis and angiogenesis" 959:
Homeodomains can bind both specifically and nonspecifically to
10003: 9632: 9622: 9502: 8898: 8455: 7804: 7255: 6992: 6486: 5958: 5787: 5777: 5772: 5564: 5559: 3314:
Bharathan G, Janssen BJ, Kellogg EA, Sinha N (December 1997).
2083: 1678: 904: 720: 57: 4684:"Classification and nomenclature of all human homeobox genes" 804:
homeobox sequence was independently reported by Ernst Hafen,
4180:"Sustained expression of homeobox D10 inhibits angiogenesis" 3955:
The International Journal of Biochemistry & Cell Biology
742:, which is observed when some of these genes are mutated in 746:. The homeobox domain was first identified in a number of 2601:
Gehring WJ (August 1992). "The homeobox in perspective".
4308:"HoxA5 stabilizes adherens junctions via increased Akt1" 1555:
genes are analogously found in four areas. They include
780:
The existence of homeobox genes was first discovered in
3486:
Mukherjee K, Brocchieri L, Bürglin TR (December 2009).
2749:
Biochimica et Biophysica Acta (BBA) - Reviews on Cancer
1069:
Mutations to homeobox genes can produce easily visible
4946:
This article incorporates text from the public domain
3537:
Wiley Interdisciplinary Reviews: Developmental Biology
2636:
Gehring WJ (December 1993). "Exploring the homeobox".
4831:(5th ed.). New York: W.H. Freeman and Company. 4406:"Identification of transcriptional targets of HOXA5" 4361:
Journal of Neuropathology and Experimental Neurology
4301: 4299: 10892: 10821: 10749: 10703: 10696: 10660: 10612: 10576: 10509: 10446: 10251: 10211: 10180: 10145: 10070: 10047: 10029: 9779: 9753: 9705: 9608: 9555: 9475: 9409: 9226: 9186: 8882: 8699: 8339: 8065: 7753: 7734: 7722: 7673: 7586: 7565: 6767: 6687: 6658: 6638: 6613: 6576: 6495: 6391: 6239: 6220: 6146: 6091: 5989: 5899: 5875: 5798: 5731: 5595: 5545: 5354: 5340: 5018: 2678:. U.S. National Library of Medicine. Archived from 218: 206: 186: 168: 163: 139: 127: 115: 103: 90: 78: 70: 65: 34: 4824: 4088:Myers C, Charboneau A, Boudreau N (January 2000). 3949:Dunn J, Simmons R, Thabet S, Jo H (October 2015). 3906:Arteriosclerosis, Thrombosis, and Vascular Biology 3535:Holland PW (2013). "Evolution of homeobox genes". 3186:Arteriosclerosis, Thrombosis, and Vascular Biology 4682:Holland PW, Booth HA, Bruford EA (October 2007). 4000:"Induction of the angiogenic phenotype by Hox D3" 792:that caused this homeotic phenotype. Analysis of 4854:(2nd ed.). New York: Garland Pub. pp.  3481: 3479: 1249:development, and formation of face structures. 930:proteins that alter the expression of genes in 2544: 2542: 2540: 10419: 10394:transcription factor/coregulator deficiencies 9465:β-Scaffold factors with minor groove contacts 4975: 4677: 4675: 4673: 4671: 4669: 4143:Journal of Cerebral Blood Flow and Metabolism 2707: 2705: 2596: 2594: 8: 4778:American Journal of Medical Genetics. Part A 1057:can silence the Hox genes by modulation of 10700: 10426: 10412: 10404: 10142: 10129: 9472: 9458: 7750: 7731: 7719: 7700: 6236: 6217: 6200: 5351: 5015: 5002: 4982: 4968: 4960: 2444:. Grouped as Pax2/5/8, Pax3/7, and Pax4/6. 1579:. Other genes considered Hox-like include 891:are connected by a short loop region. The 836:in 1984. Isolation of homologous genes by 160: 40: 4938:at the U.S. National Library of Medicine 4709: 4699: 4606: 4421: 4380: 4331: 4244: 4203: 4154: 4113: 4064: 4023: 3974: 3925: 3876: 3654: 3605: 3595: 3511: 3416: 3406: 3357: 3339: 3205: 3156: 2946: 2936: 2807: 2782:Garber RL, Kuroiwa A, Gehring WJ (1983). 2574: 27:DNA pattern affecting anatomy development 4047:Boudreau NJ, Varner JA (February 2004). 1308: 1025:and preventing cell differentiation. 1017:. Other proteins in the family, such as 2491: 2406: 10916:Index of evolutionary biology articles 2413:Grouped as Lmx 1/5, 2/9, 3/4, and 6/8. 31: 4447:Nature Reviews Molecular Cell Biology 946:in the turn which is needed to avoid 883:Helix 2 and helix 3 form a so-called 7: 3900:Dunn J, Thabet S, Jo H (July 2015). 3859:Gorski DH, Walsh K (November 2000). 3180:Dunn J, Thabet S, Jo H (July 2015). 2549:Bürglin TR, Affolter M (June 2016). 868:homeodomain (~60 amino acid chain): 6148:(1.6) Basic helix-span-helix (bHSH) 4410:The Journal of Biological Chemistry 4053:The Journal of Biological Chemistry 1005:. Many homeodomain proteins induce 895:two helices of the homeodomain are 10960:Evolutionary developmental biology 10726:Evolutionary developmental biology 4156:10.1097/01.WCB.0000141770.09022.AB 3584:Frontiers in Ecology and Evolution 2800:10.1002/j.1460-2075.1983.tb01696.x 2476:Evolutionary developmental biology 922:Homeodomain proteins are found in 25: 4850:Introduction to protein structure 4184:The American Journal of Pathology 2911:Scott MP, Weiner AJ (July 1984). 2551:"Homeodomain proteins: an update" 2422:Grouped as Six 1/2, 3/6, and 4/5. 996:Homeodomain proteins function as 10683:Evolution of sexual reproduction 4927:Eukaryotic Linear Motif resource 4644:10.1111/j.1525-142X.2007.00153.x 10135:(0) Other transcription factors 9419:transcriptional enhancer factor 5036:Activating transcription factor 4735:Journal of Experimental Zoology 4528:from the original on 2021-05-02 4488:Gruss P, Walther C (May 1992). 3492:Molecular Biology and Evolution 3296:from the original on 2012-01-02 3083:from the original on 2011-07-21 3054:from the original on 2021-05-04 2842:from the original on 2019-12-09 1241:development, generation of the 1094:since before the earliest true 887:(HTH) structure, where the two 856:The characteristic homeodomain 10454:Genotype–phenotype distinction 4270:Lymphatic Research and Biology 2603:Trends in Biochemical Sciences 1: 10711:Regulation of gene expression 9349:Interferon regulatory factors 7588:(2.5) Alternating composition 6784:General transcription factors 4312:Cell Adhesion & Migration 4196:10.1016/S0002-9440(10)64488-4 3656:10.1016/S0960-9822(02)01291-5 3272:Portoso M, Cavalli G (2008). 3231:Journal of Molecular Medicine 3102:"CATH Superfamily 1.10.10.60" 1612:"distal-less homeobox" family 1271:POU domain that contains two 164:Available protein structures: 10881:Endless Forms Most Beautiful 10661:Evolution of genetic systems 10469:Gene–environment correlation 10464:Gene–environment interaction 8634:Octamer transcription factor 5342:(1.2) Basic helix-loop-helix 4581:Bürglin TR (November 1997). 4506:10.1016/0092-8674(92)90281-G 4373:10.1097/NEN.0b013e3181a491ce 3967:10.1016/j.biocel.2015.05.001 3701:10.1016/0092-8674(84)90371-4 3408:10.1371/journal.pone.0000153 3032:10.1016/0092-8674(84)90370-2 2985:10.1016/0092-8674(84)90371-4 2761:10.1016/0304-419x(89)90033-4 2726:10.1016/0166-2236(87)90113-5 2650:10.1016/0378-1119(93)90068-E 2615:10.1016/0968-0004(92)90434-B 2511:Journal of Molecular Biology 1021:are involved in maintaining 988:of a specific target gene. 680:Homeoboxes are found within 10860:Christiane Nüsslein-Volhard 5408:Myogenic regulatory factors 4846:Tooze C, Branden J (1999). 4632:Evolution & Development 4094:The Journal of Cell Biology 4004:The Journal of Cell Biology 3629:Alonso CR (November 2002). 1331:HOXA (or sometimes HOX1) - 1003:early embryonic development 700:, and numerous single cell 10976: 10736:Hedgehog signaling pathway 10613:Developmental architecture 4945: 4887:10.1016/j.gene.2006.08.011 3918:10.1161/ATVBAHA.115.305042 3282:. Caister Academic Press. 3198:10.1161/ATVBAHA.115.305042 1260: 1225: 1210: 1131: 10913: 10563:Transgressive segregation 10389: 10141: 10128: 9471: 9457: 9228:(3.5) Tryptophan clusters 7718: 7699: 6216: 6199: 5014: 5001: 3243:10.1007/s00109-014-1181-y 2567:10.1007/s00412-015-0543-8 1181:In vertebrates, the four 1098:, making these genes pre- 715:sharing a characteristic 159: 50:homeodomain protein from 39: 10049:(4.10) Cold-shock domain 4940:Medical Subject Headings 3878:10.1161/01.res.87.10.865 3818:Cell and Tissue Research 3341:10.1073/pnas.94.25.13749 3079:. Karolinksa Institute. 1081:of segmented animals. 1007:cellular differentiation 704:. Homeobox genes encode 10741:Notch signaling pathway 10716:Gene regulatory network 10599:Dual inheritance theory 4995:intracellular receptors 4233:Journal of Cell Science 3795:10.1242/dev.122.10.2997 3597:10.3389/fevo.2016.00036 3442:Nature Reviews Genetics 2938:10.1073/pnas.81.13.4115 2676:Genetics Home Reference 1269:structurally homologous 1126:Drosophila melanogaster 1124:Hox gene expression in 1111:Types of homeobox genes 1055:Polycomb-group proteins 56:bound to a fragment of 53:Drosophila melanogaster 10940:Developmental genetics 10789:cis-regulatory element 10697:Control of development 10577:Non-genetic influences 10543:evolutionary landscape 4827:Molecular Cell Biology 4701:10.1186/1741-7007-5-47 4599:10.1093/nar/25.21.4173 4587:Nucleic Acids Research 4560:10.1242/dev.113.4.1435 4423:10.1074/jbc.M413528200 4282:10.1089/lrb.2005.3.240 4066:10.1074/jbc.M305190200 3149:10.1093/nar/20.17.4465 3137:Nucleic Acids Research 2523:10.1006/jmbi.1993.1661 1129: 880: 777: 10950:Transcription factors 10900:Nature versus nurture 10804:Cell surface receptor 10721:Evo-devo gene toolkit 10620:Developmental biology 10558:Polygenic inheritance 10484:Quantitative genetics 9758:TATA-binding proteins 4991:Transcription factors 4106:10.1083/jcb.148.2.343 4016:10.1083/jcb.139.1.257 3830:10.1007/s004410051262 3504:10.1093/molbev/msp201 1123: 1036:and their associated 998:transcription factors 976:to the DNA backbone. 972:residues, which form 878: 852:Homeodomain structure 800:genes containing the 768: 719:structure that binds 713:transcription factors 10809:Transcription factor 10524:Genetic assimilation 10511:Genetic architecture 4790:10.1002/ajmg.a.31252 4490:"Pax in development" 4324:10.4161/cam.1.4.5448 3865:Circulation Research 1302:Human homeobox genes 1293:Plant homeobox genes 1104:neofunctionalization 1045:is known to use the 955:Sequence specificity 814:Walter Jakob Gehring 740:mutational phenotype 730:is a term coined by 10905:Morphogenetic field 10822:Influential figures 10253:(0.6) Miscellaneous 9784:High-mobility group 9480:Rel homology region 6470:Testicular receptor 6211:DNA-binding domains 4747:2000JEZ...288..345C 3744:1987Natur.325..816S 3647:2002CBio...12.R776A 3578:Ferrier DE (2016). 3399:2007PLoSO...2..153R 3332:1997PNAS...9413749B 3074:"The homeobox page" 2929:1984PNAS...81.4115S 2874:1984Natur.308..428M 1156:Mutations in these 992:Biological function 818:University of Basel 18:Homeodomain protein 10594:Genomic imprinting 9618:p53 p63 p73 family 9191:Heat shock factors 4920:2021-06-01 at the 4239:(Pt 12): 2567–77. 2431:Questionable, per 1278:consensus sequence 1243:frontal eye fields 1150:Edward De Robertis 1130: 940:repressor proteins 881: 838:Edward de Robertis 830:Indiana University 828:and Amy Weiner of 778: 711:products that are 10922: 10921: 10855:Eric F. Wieschaus 10817: 10816: 10635:Pattern formation 10539:Fitness landscape 10401: 10400: 10385: 10384: 10381: 10380: 10124: 10123: 10120: 10119: 9453: 9452: 9449: 9448: 8695: 8694: 8335: 8334: 7695: 7694: 7691: 7690: 6683: 6682: 6539:Mineralocorticoid 6195: 6194: 6191: 6190: 5895: 5894: 5008:(1) Basic domains 4865:978-0-8153-2305-1 4838:978-0-7167-4366-8 4246:10.1242/jcs.02399 3789:(10): 2997–3011. 3289:978-1-904455-25-7 1550: 1549: 860:consists of a 60- 663: 662: 659: 658: 213:structure summary 16:(Redirected from 10967: 10865:William McGinnis 10834:Richard Lewontin 10829:C. H. Waddington 10701: 10678:Neutral networks 10428: 10421: 10414: 10405: 10225:-related factors 10143: 10130: 10031:(4.9) Grainyhead 9473: 9459: 9411:(3.6) TEA domain 8701:(3.2) Paired box 8342: 8076: 8070: 7764: 7758: 7751: 7747: 7741: 7732: 7720: 7709:Helix-turn-helix 7701: 6663: 6643: 6618: 6581: 6551:Estrogen related 6500: 6396: 6244: 6237: 6225:Nuclear receptor 6218: 6201: 5880: 5801: 5734: 5603: 5548: 5357: 5352: 5016: 5003: 4984: 4977: 4970: 4961: 4898: 4869: 4853: 4842: 4830: 4810: 4809: 4773: 4767: 4766: 4730: 4724: 4723: 4713: 4703: 4679: 4664: 4663: 4627: 4621: 4620: 4610: 4578: 4572: 4571: 4543: 4537: 4536: 4534: 4533: 4485: 4479: 4478: 4442: 4436: 4435: 4425: 4416:(19): 19373–80. 4401: 4395: 4394: 4384: 4352: 4346: 4345: 4335: 4303: 4294: 4293: 4265: 4259: 4258: 4248: 4224: 4218: 4217: 4207: 4175: 4169: 4168: 4158: 4134: 4128: 4127: 4117: 4085: 4079: 4078: 4068: 4044: 4038: 4037: 4027: 3995: 3989: 3988: 3978: 3946: 3940: 3939: 3929: 3897: 3891: 3890: 3880: 3856: 3850: 3849: 3813: 3807: 3806: 3778: 3772: 3771: 3752:10.1038/325816a0 3727: 3721: 3720: 3683: 3677: 3676: 3658: 3626: 3620: 3619: 3609: 3599: 3575: 3569: 3568: 3532: 3526: 3525: 3515: 3483: 3474: 3473: 3437: 3431: 3430: 3420: 3410: 3378: 3372: 3371: 3361: 3343: 3326:(25): 13749–53. 3311: 3305: 3304: 3302: 3301: 3269: 3263: 3262: 3226: 3220: 3219: 3209: 3177: 3171: 3170: 3160: 3128: 3122: 3121: 3119: 3117: 3112:on 9 August 2017 3108:. Archived from 3098: 3092: 3091: 3089: 3088: 3078: 3069: 3063: 3062: 3060: 3059: 3011: 3005: 3004: 2967: 2961: 2960: 2950: 2940: 2908: 2902: 2901: 2882:10.1038/308428a0 2868:(5958): 428–33. 2857: 2851: 2850: 2848: 2847: 2828: 2822: 2821: 2811: 2788:The EMBO Journal 2779: 2773: 2772: 2744: 2738: 2737: 2709: 2700: 2697: 2691: 2690: 2688: 2687: 2668: 2662: 2661: 2633: 2627: 2626: 2598: 2589: 2588: 2578: 2546: 2535: 2534: 2506: 2496: 2463: 2460: 2454: 2451: 2445: 2438: 2432: 2429: 2423: 2420: 2414: 2411: 1309: 1273:helix-turn-helix 911:and the exposed 885:helix-turn-helix 826:Matthew P. Scott 810:William McGinnis 654: 648: 642: 636: 630: 624: 618: 612: 606: 600: 594: 588: 582: 576: 570: 564: 558: 552: 546: 540: 534: 528: 522: 516: 510: 504: 498: 492: 486: 480: 474: 468: 462: 456: 450: 444: 438: 432: 426: 420: 414: 408: 402: 396: 390: 384: 378: 372: 366: 360: 354: 348: 342: 336: 330: 324: 318: 312: 306: 300: 294: 288: 282: 276: 270: 264: 258: 252: 246: 240: 234: 228: 161: 44: 32: 21: 10975: 10974: 10970: 10969: 10968: 10966: 10965: 10964: 10945:Protein domains 10925: 10924: 10923: 10918: 10909: 10888: 10875:Sean B. Carroll 10813: 10745: 10692: 10656: 10608: 10589:Maternal effect 10572: 10505: 10442: 10432: 10402: 10397: 10377: 10247: 10207: 10176: 10137: 10116: 10066: 10043: 10025: 9775: 9749: 9701: 9604: 9551: 9467: 9445: 9405: 9222: 9182: 8878: 8691: 8340: 8331: 8072: 8071: 8066: 8061: 7760: 7759: 7754: 7743: 7742: 7735: 7714: 7687: 7669: 7582: 7570: 7561: 6776: 6772: 6763: 6692: 6689:(2.2) Other Cys 6679: 6659: 6654: 6639: 6634: 6614: 6609: 6577: 6572: 6507:Steroid hormone 6496: 6491: 6392: 6387: 6251:Thyroid hormone 6240: 6231: 6212: 6187: 6142: 6087: 5985: 5891: 5878: 5876: 5871: 5799: 5794: 5732: 5727: 5598: 5596: 5591: 5546: 5541: 5355: 5336: 5010: 4997: 4988: 4958: 4922:Wayback Machine 4906: 4901: 4872: 4866: 4845: 4839: 4822: 4818: 4816:Further reading 4813: 4784:(13): 1366–74. 4775: 4774: 4770: 4732: 4731: 4727: 4681: 4680: 4667: 4629: 4628: 4624: 4593:(21): 4173–80. 4580: 4579: 4575: 4545: 4544: 4540: 4531: 4529: 4487: 4486: 4482: 4459:10.1038/nrm1499 4444: 4443: 4439: 4403: 4402: 4398: 4354: 4353: 4349: 4305: 4304: 4297: 4267: 4266: 4262: 4226: 4225: 4221: 4190:(6): 2099–109. 4177: 4176: 4172: 4136: 4135: 4131: 4087: 4086: 4082: 4046: 4045: 4041: 3997: 3996: 3992: 3948: 3947: 3943: 3899: 3898: 3894: 3858: 3857: 3853: 3815: 3814: 3810: 3780: 3779: 3775: 3738:(6107): 816–8. 3729: 3728: 3724: 3685: 3684: 3680: 3635:Current Biology 3628: 3627: 3623: 3577: 3576: 3572: 3549:10.1002/wdev.78 3534: 3533: 3529: 3498:(12): 2775–94. 3485: 3484: 3477: 3454:10.1038/nrg1723 3439: 3438: 3434: 3380: 3379: 3375: 3313: 3312: 3308: 3299: 3297: 3290: 3271: 3270: 3266: 3228: 3227: 3223: 3179: 3178: 3174: 3143:(17): 4465–72. 3130: 3129: 3125: 3115: 3113: 3106:www.cathdb.info 3100: 3099: 3095: 3086: 3084: 3076: 3071: 3070: 3066: 3057: 3055: 3013: 3012: 3008: 2969: 2968: 2964: 2910: 2909: 2905: 2859: 2858: 2854: 2845: 2843: 2830: 2829: 2825: 2794:(11): 2027–36. 2781: 2780: 2776: 2746: 2745: 2741: 2714:Trends Neurosci 2711: 2710: 2703: 2698: 2694: 2685: 2683: 2670: 2669: 2665: 2644:(1–2): 215–21. 2635: 2634: 2630: 2600: 2599: 2592: 2548: 2547: 2538: 2508: 2498: 2497: 2493: 2489: 2472: 2467: 2466: 2461: 2457: 2452: 2448: 2439: 2435: 2430: 2426: 2421: 2417: 2412: 2408: 1304: 1295: 1285:, particularly 1265: 1259: 1230: 1224: 1215: 1209: 1136: 1118: 1113: 1087: 1067: 1031: 994: 986:promoter region 957: 899:and the longer 873: 854: 763: 732:William Bateson 650: 644: 638: 632: 626: 620: 614: 608: 602: 596: 590: 584: 578: 572: 566: 560: 554: 548: 542: 536: 530: 524: 518: 512: 506: 500: 494: 488: 482: 476: 470: 464: 458: 452: 446: 440: 434: 428: 422: 416: 410: 404: 398: 392: 386: 380: 374: 368: 362: 356: 350: 344: 338: 332: 326: 320: 314: 308: 302: 296: 290: 284: 278: 272: 266: 260: 254: 248: 242: 236: 230: 224: 61: 28: 23: 22: 15: 12: 11: 5: 10973: 10971: 10963: 10962: 10957: 10955:Homeobox genes 10952: 10947: 10942: 10937: 10927: 10926: 10920: 10919: 10914: 10911: 10910: 10908: 10907: 10902: 10896: 10894: 10890: 10889: 10887: 10886: 10885: 10884: 10872: 10867: 10862: 10857: 10852: 10851: 10850: 10839:François Jacob 10836: 10831: 10825: 10823: 10819: 10818: 10815: 10814: 10812: 10811: 10806: 10801: 10796: 10791: 10786: 10781: 10776: 10775: 10774: 10764: 10759: 10753: 10751: 10747: 10746: 10744: 10743: 10738: 10733: 10728: 10723: 10718: 10713: 10707: 10705: 10698: 10694: 10693: 10691: 10690: 10685: 10680: 10675: 10670: 10664: 10662: 10658: 10657: 10655: 10654: 10649: 10644: 10639: 10638: 10637: 10632: 10622: 10616: 10614: 10610: 10609: 10607: 10606: 10601: 10596: 10591: 10586: 10580: 10578: 10574: 10573: 10571: 10570: 10568:Sequence space 10565: 10560: 10555: 10550: 10545: 10536: 10531: 10526: 10521: 10515: 10513: 10507: 10506: 10504: 10503: 10498: 10497: 10496: 10486: 10481: 10476: 10471: 10466: 10461: 10456: 10450: 10448: 10444: 10443: 10433: 10431: 10430: 10423: 10416: 10408: 10399: 10398: 10390: 10387: 10386: 10383: 10382: 10379: 10378: 10376: 10375: 10366: 10365: 10364: 10359: 10354: 10344: 10339: 10338: 10337: 10332: 10327: 10317: 10316: 10315: 10310: 10300: 10295: 10294: 10293: 10288: 10283: 10278: 10273: 10268: 10257: 10255: 10249: 10248: 10246: 10245: 10240: 10235: 10229: 10227: 10209: 10208: 10206: 10205: 10200: 10195: 10189: 10187: 10178: 10177: 10175: 10174: 10169: 10168: 10167: 10162: 10151: 10149: 10139: 10138: 10133: 10126: 10125: 10122: 10121: 10118: 10117: 10115: 10114: 10113: 10112: 10107: 10102: 10097: 10092: 10087: 10076: 10074: 10068: 10067: 10065: 10064: 10059: 10053: 10051: 10045: 10044: 10042: 10041: 10035: 10033: 10027: 10026: 10024: 10023: 10022: 10021: 10016: 10011: 10006: 9996: 9995: 9994: 9989: 9988: 9987: 9982: 9977: 9962: 9957: 9952: 9951: 9950: 9945: 9940: 9935: 9930: 9925: 9920: 9915: 9910: 9905: 9900: 9895: 9890: 9885: 9880: 9875: 9865: 9864: 9863: 9858: 9848: 9847: 9846: 9841: 9836: 9831: 9821: 9820: 9819: 9814: 9809: 9804: 9794: 9788: 9786: 9777: 9776: 9774: 9773: 9768: 9762: 9760: 9751: 9750: 9748: 9747: 9742: 9741: 9740: 9735: 9730: 9725: 9714: 9712: 9703: 9702: 9700: 9699: 9694: 9693: 9692: 9687: 9682: 9677: 9672: 9667: 9662: 9657: 9652: 9647: 9637: 9636: 9635: 9630: 9625: 9614: 9612: 9610:(4.3) p53-like 9606: 9605: 9603: 9602: 9601: 9600: 9595: 9590: 9585: 9580: 9575: 9564: 9562: 9553: 9552: 9550: 9549: 9548: 9547: 9542: 9537: 9532: 9527: 9517: 9516: 9515: 9510: 9505: 9500: 9495: 9484: 9482: 9469: 9468: 9462: 9455: 9454: 9451: 9450: 9447: 9446: 9444: 9443: 9442: 9441: 9436: 9431: 9426: 9415: 9413: 9407: 9406: 9404: 9403: 9398: 9393: 9392: 9391: 9386: 9381: 9376: 9371: 9366: 9361: 9356: 9346: 9341: 9340: 9339: 9334: 9329: 9324: 9314: 9313: 9312: 9307: 9302: 9297: 9287: 9282: 9281: 9280: 9275: 9270: 9260: 9255: 9254: 9253: 9248: 9243: 9232: 9230: 9224: 9223: 9221: 9220: 9219: 9218: 9213: 9208: 9195: 9193: 9184: 9183: 9181: 9180: 9179: 9178: 9173: 9168: 9163: 9158: 9153: 9148: 9143: 9138: 9133: 9128: 9123: 9118: 9113: 9108: 9103: 9098: 9093: 9088: 9083: 9078: 9073: 9068: 9063: 9058: 9053: 9048: 9043: 9038: 9033: 9028: 9023: 9018: 9013: 9008: 9003: 8998: 8993: 8988: 8983: 8978: 8973: 8968: 8963: 8958: 8953: 8948: 8943: 8938: 8928: 8927: 8926: 8921: 8916: 8911: 8906: 8895: 8893: 8880: 8879: 8877: 8876: 8875: 8874: 8873: 8872: 8867: 8862: 8852: 8851: 8850: 8845: 8835: 8830: 8820: 8815: 8810: 8805: 8800: 8795: 8794: 8793: 8788: 8778: 8773: 8772: 8771: 8766: 8758: 8757: 8756: 8751: 8746: 8741: 8736: 8731: 8726: 8721: 8716: 8705: 8703: 8697: 8696: 8693: 8692: 8690: 8689: 8688: 8687: 8682: 8672: 8667: 8666: 8665: 8660: 8655: 8650: 8645: 8640: 8631: 8626: 8621: 8612: 8602: 8601: 8600: 8595: 8590: 8585: 8580: 8575: 8570: 8565: 8560: 8550: 8549: 8548: 8547: 8546: 8541: 8536: 8531: 8526: 8516: 8515: 8514: 8509: 8499: 8498: 8497: 8492: 8487: 8477: 8476: 8475: 8470: 8460: 8459: 8458: 8453: 8448: 8443: 8438: 8433: 8428: 8415: 8410: 8409: 8408: 8403: 8393: 8388: 8383: 8382: 8381: 8376: 8371: 8361: 8356: 8351: 8345: 8343: 8337: 8336: 8333: 8332: 8330: 8329: 8324: 8319: 8314: 8309: 8304: 8299: 8298: 8297: 8292: 8287: 8282: 8277: 8272: 8267: 8262: 8257: 8252: 8247: 8237: 8232: 8231: 8230: 8225: 8215: 8210: 8205: 8200: 8195: 8194: 8193: 8188: 8178: 8177: 8176: 8171: 8159: 8158: 8157: 8152: 8147: 8142: 8137: 8132: 8122: 8121: 8120: 8115: 8105: 8100: 8095: 8090: 8085: 8079: 8077: 8063: 8062: 8060: 8059: 8054: 8049: 8044: 8043: 8042: 8037: 8032: 8027: 8022: 8017: 8012: 8007: 8002: 7997: 7992: 7987: 7982: 7977: 7972: 7967: 7962: 7957: 7952: 7947: 7942: 7937: 7932: 7927: 7922: 7917: 7912: 7907: 7902: 7897: 7892: 7887: 7882: 7877: 7872: 7867: 7862: 7857: 7847: 7842: 7837: 7832: 7828:extended Hox: 7826: 7825: 7824: 7823: 7822: 7817: 7812: 7802: 7801: 7800: 7790: 7789: 7788: 7783: 7767: 7765: 7748: 7729: 7716: 7715: 7704: 7697: 7696: 7693: 7692: 7689: 7688: 7686: 7685: 7679: 7677: 7671: 7670: 7668: 7667: 7662: 7661: 7660: 7655: 7650: 7645: 7640: 7630: 7629: 7628: 7623: 7618: 7608: 7603: 7598: 7592: 7590: 7584: 7583: 7581: 7580: 7574: 7572: 7568: 7563: 7562: 7560: 7559: 7558: 7557: 7552: 7547: 7542: 7537: 7532: 7527: 7522: 7517: 7512: 7507: 7502: 7497: 7492: 7487: 7482: 7477: 7472: 7467: 7462: 7457: 7452: 7447: 7442: 7437: 7432: 7427: 7422: 7417: 7412: 7407: 7402: 7397: 7392: 7387: 7382: 7377: 7372: 7367: 7362: 7357: 7352: 7347: 7342: 7337: 7332: 7322: 7321: 7320: 7315: 7310: 7305: 7300: 7295: 7290: 7285: 7275: 7274: 7273: 7268: 7258: 7253: 7248: 7247: 7246: 7241: 7236: 7231: 7221: 7216: 7211: 7206: 7201: 7200: 7199: 7198: 7197: 7192: 7187: 7182: 7177: 7167: 7166: 7165: 7160: 7155: 7150: 7145: 7140: 7135: 7130: 7125: 7120: 7115: 7110: 7105: 7100: 7095: 7090: 7075: 7074: 7073: 7068: 7058: 7057: 7056: 7051: 7046: 7036: 7035: 7034: 7029: 7024: 7014: 7013: 7012: 7007: 6997: 6996: 6995: 6990: 6985: 6980: 6975: 6970: 6965: 6955: 6950: 6945: 6944: 6943: 6938: 6933: 6928: 6918: 6913: 6908: 6907: 6906: 6901: 6896: 6884: 6878: 6877: 6876: 6875: 6874: 6873: 6868: 6863: 6858: 6853: 6848: 6843: 6838: 6828: 6823: 6818: 6817: 6816: 6811: 6801: 6796: 6791: 6780: 6778: 6774: 6770: 6765: 6764: 6762: 6761: 6756: 6755: 6754: 6749: 6744: 6734: 6733: 6732: 6727: 6722: 6717: 6712: 6707: 6696: 6694: 6690: 6685: 6684: 6681: 6680: 6678: 6677: 6672: 6666: 6664: 6656: 6655: 6653: 6652: 6646: 6644: 6636: 6635: 6633: 6632: 6627: 6621: 6619: 6611: 6610: 6608: 6607: 6606: 6605: 6600: 6595: 6584: 6582: 6574: 6573: 6571: 6570: 6569: 6568: 6563: 6558: 6548: 6547: 6546: 6541: 6536: 6534:Glucocorticoid 6531: 6530: 6529: 6524: 6514: 6503: 6501: 6493: 6492: 6490: 6489: 6484: 6483: 6482: 6477: 6467: 6466: 6465: 6460: 6455: 6445: 6440: 6439: 6438: 6433: 6423: 6418: 6417: 6416: 6411: 6399: 6397: 6389: 6388: 6386: 6385: 6380: 6379: 6378: 6373: 6363: 6362: 6361: 6356: 6351: 6341: 6340: 6339: 6334: 6329: 6319: 6314: 6313: 6312: 6307: 6302: 6292: 6291: 6290: 6285: 6275: 6270: 6265: 6264: 6263: 6258: 6247: 6245: 6234: 6229: 6214: 6213: 6204: 6197: 6196: 6193: 6192: 6189: 6188: 6186: 6185: 6184: 6183: 6178: 6173: 6168: 6163: 6152: 6150: 6144: 6143: 6141: 6140: 6139: 6138: 6133: 6128: 6123: 6118: 6113: 6108: 6097: 6095: 6089: 6088: 6086: 6085: 6084: 6083: 6077: 6076: 6075: 6070: 6060: 6059: 6058: 6053: 6048: 6043: 6038: 6023: 6022: 6021: 6016: 6011: 6006: 5995: 5993: 5987: 5986: 5984: 5983: 5978: 5977: 5976: 5971: 5961: 5956: 5951: 5946: 5941: 5936: 5931: 5930: 5929: 5924: 5914: 5908: 5906: 5897: 5896: 5893: 5892: 5890: 5889: 5883: 5881: 5873: 5872: 5870: 5869: 5868: 5867: 5862: 5857: 5847: 5846: 5845: 5840: 5835: 5830: 5825: 5820: 5815: 5804: 5802: 5796: 5795: 5793: 5792: 5791: 5790: 5785: 5780: 5775: 5765: 5760: 5759: 5758: 5753: 5748: 5737: 5735: 5729: 5728: 5726: 5725: 5724: 5723: 5718: 5708: 5707: 5706: 5701: 5696: 5691: 5681: 5680: 5679: 5674: 5669: 5661: 5660: 5659: 5654: 5649: 5639: 5634: 5633: 5632: 5627: 5617: 5612: 5606: 5604: 5593: 5592: 5590: 5589: 5584: 5579: 5578: 5577: 5572: 5567: 5557: 5551: 5549: 5543: 5542: 5540: 5539: 5534: 5533: 5532: 5531: 5530: 5525: 5515: 5505: 5504: 5503: 5498: 5488: 5487: 5486: 5481: 5471: 5470: 5469: 5464: 5459: 5449: 5448: 5447: 5442: 5432: 5431: 5430: 5425: 5420: 5415: 5405: 5400: 5399: 5398: 5393: 5383: 5378: 5377: 5376: 5371: 5360: 5358: 5349: 5338: 5337: 5335: 5334: 5329: 5328: 5327: 5322: 5317: 5307: 5302: 5297: 5296: 5295: 5290: 5285: 5280: 5270: 5269: 5268: 5263: 5258: 5253: 5243: 5238: 5233: 5228: 5223: 5218: 5213: 5212: 5211: 5206: 5201: 5191: 5190: 5189: 5184: 5179: 5174: 5169: 5164: 5154: 5149: 5144: 5143: 5142: 5137: 5127: 5126: 5125: 5120: 5115: 5110: 5105: 5100: 5095: 5090: 5080: 5079: 5078: 5073: 5068: 5063: 5058: 5053: 5048: 5043: 5032: 5030: 5023:leucine zipper 5012: 5011: 5006: 4999: 4998: 4989: 4987: 4986: 4979: 4972: 4964: 4944: 4943: 4933: 4924: 4912: 4905: 4904:External links 4902: 4900: 4899: 4881:(1–2): 21–30. 4870: 4864: 4843: 4837: 4819: 4817: 4814: 4812: 4811: 4768: 4741:(4): 345–351. 4725: 4665: 4622: 4573: 4554:(4): 1435–49. 4538: 4480: 4453:(11): 920–31. 4437: 4396: 4347: 4295: 4260: 4219: 4170: 4149:(11): 1280–7. 4129: 4080: 4039: 3990: 3941: 3892: 3871:(10): 865–72. 3851: 3808: 3773: 3722: 3678: 3641:(22): R776-8. 3621: 3570: 3527: 3475: 3448:(12): 881–92. 3432: 3373: 3306: 3288: 3264: 3221: 3172: 3123: 3093: 3064: 3006: 2979:(2): 409–414. 2962: 2923:(13): 4115–9. 2903: 2852: 2836:embryo.asu.edu 2823: 2774: 2739: 2701: 2692: 2663: 2628: 2590: 2561:(3): 497–521. 2536: 2517:(4): 1084–93. 2490: 2488: 2485: 2484: 2483: 2478: 2471: 2468: 2465: 2464: 2455: 2446: 2433: 2424: 2415: 2405: 2404: 2403: 2402: 2401: 2400: 2222: 1996: 1945: 1914: 1888: 1873: 1850: 1776: 1610:Humans have a 1548: 1547: 1510: 1505: 1496: 1495: 1458: 1453: 1444: 1443: 1402: 1397: 1388: 1387: 1342: 1337: 1328: 1327: 1322: 1315: 1303: 1300: 1294: 1291: 1283:bacteriophages 1261:Main article: 1258: 1255: 1239:nervous system 1226:Main article: 1223: 1220: 1211:Main article: 1208: 1205: 1158:homeotic genes 1132:Main article: 1117: 1114: 1112: 1109: 1086: 1083: 1066: 1063: 1030: 1027: 993: 990: 974:hydrogen bonds 956: 953: 870: 853: 850: 806:Michael Levine 762: 759: 661: 660: 657: 656: 222: 216: 215: 210: 204: 203: 190: 184: 183: 173: 166: 165: 157: 156: 143: 137: 136: 131: 125: 124: 119: 113: 112: 107: 101: 100: 95: 88: 87: 82: 76: 75: 72: 68: 67: 63: 62: 45: 37: 36: 26: 24: 14: 13: 10: 9: 6: 4: 3: 2: 10972: 10961: 10958: 10956: 10953: 10951: 10948: 10946: 10943: 10941: 10938: 10936: 10933: 10932: 10930: 10917: 10912: 10906: 10903: 10901: 10898: 10897: 10895: 10891: 10883: 10882: 10878: 10877: 10876: 10873: 10871: 10868: 10866: 10863: 10861: 10858: 10856: 10853: 10849: 10846: 10845: 10844: 10843:Jacques Monod 10840: 10837: 10835: 10832: 10830: 10827: 10826: 10824: 10820: 10810: 10807: 10805: 10802: 10800: 10797: 10795: 10792: 10790: 10787: 10785: 10782: 10780: 10777: 10773: 10770: 10769: 10768: 10765: 10763: 10760: 10758: 10757:Homeotic gene 10755: 10754: 10752: 10748: 10742: 10739: 10737: 10734: 10732: 10729: 10727: 10724: 10722: 10719: 10717: 10714: 10712: 10709: 10708: 10706: 10702: 10699: 10695: 10689: 10686: 10684: 10681: 10679: 10676: 10674: 10671: 10669: 10666: 10665: 10663: 10659: 10653: 10650: 10648: 10645: 10643: 10640: 10636: 10633: 10631: 10628: 10627: 10626: 10625:Morphogenesis 10623: 10621: 10618: 10617: 10615: 10611: 10605: 10602: 10600: 10597: 10595: 10592: 10590: 10587: 10585: 10582: 10581: 10579: 10575: 10569: 10566: 10564: 10561: 10559: 10556: 10554: 10551: 10549: 10546: 10544: 10540: 10537: 10535: 10532: 10530: 10527: 10525: 10522: 10520: 10517: 10516: 10514: 10512: 10508: 10502: 10499: 10495: 10492: 10491: 10490: 10487: 10485: 10482: 10480: 10477: 10475: 10472: 10470: 10467: 10465: 10462: 10460: 10459:Reaction norm 10457: 10455: 10452: 10451: 10449: 10445: 10441: 10437: 10429: 10424: 10422: 10417: 10415: 10410: 10409: 10406: 10396: 10395: 10388: 10374: 10370: 10367: 10363: 10360: 10358: 10355: 10353: 10350: 10349: 10348: 10345: 10343: 10340: 10336: 10333: 10331: 10328: 10326: 10323: 10322: 10321: 10318: 10314: 10311: 10309: 10306: 10305: 10304: 10301: 10299: 10296: 10292: 10289: 10287: 10284: 10282: 10279: 10277: 10274: 10272: 10269: 10267: 10264: 10263: 10262: 10259: 10258: 10256: 10254: 10250: 10244: 10241: 10239: 10236: 10234: 10231: 10230: 10228: 10226: 10223: 10220: 10217: 10214: 10210: 10204: 10201: 10199: 10196: 10194: 10191: 10190: 10188: 10186: 10185:Pocket domain 10183: 10179: 10173: 10170: 10166: 10163: 10161: 10158: 10157: 10156: 10153: 10152: 10150: 10148: 10147:(0.2) HMGI(Y) 10144: 10140: 10136: 10131: 10127: 10111: 10108: 10106: 10103: 10101: 10098: 10096: 10093: 10091: 10088: 10086: 10083: 10082: 10081: 10078: 10077: 10075: 10073: 10069: 10063: 10060: 10058: 10055: 10054: 10052: 10050: 10046: 10040: 10037: 10036: 10034: 10032: 10028: 10020: 10017: 10015: 10012: 10010: 10007: 10005: 10002: 10001: 10000: 9997: 9993: 9990: 9986: 9983: 9981: 9978: 9976: 9973: 9972: 9971: 9968: 9967: 9966: 9963: 9961: 9958: 9956: 9953: 9949: 9946: 9944: 9941: 9939: 9936: 9934: 9931: 9929: 9926: 9924: 9921: 9919: 9916: 9914: 9911: 9909: 9906: 9904: 9901: 9899: 9896: 9894: 9891: 9889: 9886: 9884: 9881: 9879: 9876: 9874: 9871: 9870: 9869: 9866: 9862: 9859: 9857: 9854: 9853: 9852: 9849: 9845: 9842: 9840: 9837: 9835: 9832: 9830: 9827: 9826: 9825: 9822: 9818: 9815: 9813: 9810: 9808: 9805: 9803: 9800: 9799: 9798: 9795: 9793: 9790: 9789: 9787: 9785: 9782: 9778: 9772: 9769: 9767: 9764: 9763: 9761: 9759: 9756: 9752: 9746: 9743: 9739: 9736: 9734: 9731: 9729: 9726: 9724: 9721: 9720: 9719: 9716: 9715: 9713: 9711: 9708: 9704: 9698: 9695: 9691: 9688: 9686: 9683: 9681: 9678: 9676: 9673: 9671: 9668: 9666: 9663: 9661: 9658: 9656: 9653: 9651: 9648: 9646: 9643: 9642: 9641: 9638: 9634: 9631: 9629: 9626: 9624: 9621: 9620: 9619: 9616: 9615: 9613: 9611: 9607: 9599: 9596: 9594: 9591: 9589: 9586: 9584: 9581: 9579: 9576: 9574: 9571: 9570: 9569: 9566: 9565: 9563: 9561: 9558: 9554: 9546: 9543: 9541: 9538: 9536: 9533: 9531: 9528: 9526: 9523: 9522: 9521: 9518: 9514: 9511: 9509: 9506: 9504: 9501: 9499: 9496: 9494: 9491: 9490: 9489: 9486: 9485: 9483: 9481: 9478: 9474: 9470: 9466: 9460: 9456: 9440: 9437: 9435: 9432: 9430: 9427: 9425: 9422: 9421: 9420: 9417: 9416: 9414: 9412: 9408: 9402: 9399: 9397: 9394: 9390: 9387: 9385: 9382: 9380: 9377: 9375: 9372: 9370: 9367: 9365: 9362: 9360: 9357: 9355: 9352: 9351: 9350: 9347: 9345: 9342: 9338: 9335: 9333: 9330: 9328: 9325: 9323: 9320: 9319: 9318: 9315: 9311: 9308: 9306: 9303: 9301: 9298: 9296: 9293: 9292: 9291: 9288: 9286: 9283: 9279: 9276: 9274: 9271: 9269: 9266: 9265: 9264: 9261: 9259: 9256: 9252: 9249: 9247: 9244: 9242: 9239: 9238: 9237: 9234: 9233: 9231: 9229: 9225: 9217: 9214: 9212: 9209: 9207: 9204: 9203: 9202: 9201: 9197: 9196: 9194: 9192: 9189: 9185: 9177: 9174: 9172: 9169: 9167: 9164: 9162: 9159: 9157: 9154: 9152: 9149: 9147: 9144: 9142: 9139: 9137: 9134: 9132: 9129: 9127: 9124: 9122: 9119: 9117: 9114: 9112: 9109: 9107: 9104: 9102: 9099: 9097: 9094: 9092: 9089: 9087: 9084: 9082: 9079: 9077: 9074: 9072: 9069: 9067: 9064: 9062: 9059: 9057: 9054: 9052: 9049: 9047: 9044: 9042: 9039: 9037: 9034: 9032: 9029: 9027: 9024: 9022: 9019: 9017: 9014: 9012: 9009: 9007: 9004: 9002: 8999: 8997: 8994: 8992: 8989: 8987: 8984: 8982: 8979: 8977: 8974: 8972: 8969: 8967: 8964: 8962: 8959: 8957: 8954: 8952: 8949: 8947: 8944: 8942: 8939: 8937: 8934: 8933: 8932: 8929: 8925: 8922: 8920: 8917: 8915: 8912: 8910: 8907: 8905: 8902: 8901: 8900: 8897: 8896: 8894: 8892: 8888: 8885: 8881: 8871: 8868: 8866: 8863: 8861: 8858: 8857: 8856: 8853: 8849: 8846: 8844: 8841: 8840: 8839: 8836: 8834: 8831: 8829: 8826: 8825: 8824: 8821: 8819: 8816: 8814: 8811: 8809: 8806: 8804: 8801: 8799: 8796: 8792: 8789: 8787: 8784: 8783: 8782: 8779: 8777: 8774: 8770: 8767: 8765: 8762: 8761: 8759: 8755: 8752: 8750: 8747: 8745: 8742: 8740: 8737: 8735: 8732: 8730: 8727: 8725: 8722: 8720: 8717: 8715: 8712: 8711: 8710: 8707: 8706: 8704: 8702: 8698: 8686: 8683: 8681: 8678: 8677: 8676: 8673: 8671: 8668: 8664: 8661: 8659: 8656: 8654: 8651: 8649: 8646: 8644: 8641: 8639: 8635: 8632: 8630: 8627: 8625: 8622: 8620: 8616: 8613: 8611: 8608: 8607: 8606: 8603: 8599: 8596: 8594: 8591: 8589: 8586: 8584: 8581: 8579: 8576: 8574: 8571: 8569: 8566: 8564: 8561: 8559: 8556: 8555: 8554: 8551: 8545: 8542: 8540: 8537: 8535: 8532: 8530: 8527: 8525: 8522: 8521: 8520: 8517: 8513: 8510: 8508: 8505: 8504: 8503: 8500: 8496: 8493: 8491: 8488: 8486: 8483: 8482: 8481: 8478: 8474: 8471: 8469: 8466: 8465: 8464: 8461: 8457: 8454: 8452: 8449: 8447: 8444: 8442: 8439: 8437: 8434: 8432: 8429: 8427: 8424: 8423: 8422: 8419: 8418: 8416: 8414: 8411: 8407: 8404: 8402: 8399: 8398: 8397: 8394: 8392: 8389: 8387: 8384: 8380: 8377: 8375: 8372: 8370: 8367: 8366: 8365: 8362: 8360: 8357: 8355: 8352: 8350: 8347: 8346: 8344: 8338: 8328: 8325: 8323: 8320: 8318: 8315: 8313: 8310: 8308: 8305: 8303: 8300: 8296: 8293: 8291: 8288: 8286: 8283: 8281: 8278: 8276: 8273: 8271: 8268: 8266: 8263: 8261: 8258: 8256: 8253: 8251: 8248: 8246: 8243: 8242: 8241: 8238: 8236: 8233: 8229: 8226: 8224: 8221: 8220: 8219: 8216: 8214: 8211: 8209: 8206: 8204: 8201: 8199: 8196: 8192: 8189: 8187: 8184: 8183: 8182: 8179: 8175: 8172: 8170: 8167: 8166: 8165: 8164: 8160: 8156: 8153: 8151: 8148: 8146: 8143: 8141: 8138: 8136: 8133: 8131: 8128: 8127: 8126: 8123: 8119: 8116: 8114: 8111: 8110: 8109: 8106: 8104: 8101: 8099: 8096: 8094: 8091: 8089: 8086: 8084: 8081: 8080: 8078: 8075: 8069: 8064: 8058: 8055: 8053: 8050: 8048: 8045: 8041: 8038: 8036: 8033: 8031: 8028: 8026: 8023: 8021: 8018: 8016: 8013: 8011: 8008: 8006: 8003: 8001: 7998: 7996: 7993: 7991: 7988: 7986: 7983: 7981: 7978: 7976: 7973: 7971: 7968: 7966: 7963: 7961: 7958: 7956: 7953: 7951: 7948: 7946: 7943: 7941: 7938: 7936: 7933: 7931: 7928: 7926: 7923: 7921: 7918: 7916: 7913: 7911: 7908: 7906: 7903: 7901: 7898: 7896: 7893: 7891: 7888: 7886: 7883: 7881: 7878: 7876: 7873: 7871: 7868: 7866: 7863: 7861: 7858: 7856: 7853: 7852: 7851: 7848: 7846: 7843: 7841: 7838: 7836: 7833: 7831: 7827: 7821: 7818: 7816: 7813: 7811: 7808: 7807: 7806: 7803: 7799: 7796: 7795: 7794: 7791: 7787: 7784: 7782: 7779: 7778: 7777: 7774: 7773: 7772: 7769: 7768: 7766: 7763: 7757: 7752: 7749: 7746: 7740: 7739: 7733: 7730: 7728: 7725: 7721: 7717: 7713: 7710: 7707: 7702: 7698: 7684: 7681: 7680: 7678: 7676: 7672: 7666: 7663: 7659: 7656: 7654: 7651: 7649: 7646: 7644: 7641: 7639: 7636: 7635: 7634: 7631: 7627: 7624: 7622: 7619: 7617: 7614: 7613: 7612: 7609: 7607: 7604: 7602: 7599: 7597: 7594: 7593: 7591: 7589: 7585: 7579: 7576: 7575: 7573: 7571: 7564: 7556: 7553: 7551: 7548: 7546: 7543: 7541: 7538: 7536: 7533: 7531: 7528: 7526: 7523: 7521: 7518: 7516: 7513: 7511: 7508: 7506: 7503: 7501: 7498: 7496: 7493: 7491: 7488: 7486: 7483: 7481: 7478: 7476: 7473: 7471: 7468: 7466: 7463: 7461: 7458: 7456: 7453: 7451: 7448: 7446: 7443: 7441: 7438: 7436: 7433: 7431: 7428: 7426: 7423: 7421: 7418: 7416: 7413: 7411: 7408: 7406: 7403: 7401: 7398: 7396: 7393: 7391: 7388: 7386: 7383: 7381: 7378: 7376: 7373: 7371: 7368: 7366: 7363: 7361: 7358: 7356: 7353: 7351: 7348: 7346: 7343: 7341: 7338: 7336: 7333: 7331: 7328: 7327: 7326: 7323: 7319: 7316: 7314: 7311: 7309: 7306: 7304: 7301: 7299: 7296: 7294: 7291: 7289: 7286: 7284: 7281: 7280: 7279: 7276: 7272: 7269: 7267: 7264: 7263: 7262: 7259: 7257: 7254: 7252: 7249: 7245: 7242: 7240: 7237: 7235: 7232: 7230: 7227: 7226: 7225: 7222: 7220: 7217: 7215: 7212: 7210: 7207: 7205: 7202: 7196: 7193: 7191: 7188: 7186: 7183: 7181: 7178: 7176: 7173: 7172: 7171: 7168: 7164: 7161: 7159: 7156: 7154: 7151: 7149: 7146: 7144: 7141: 7139: 7136: 7134: 7131: 7129: 7126: 7124: 7121: 7119: 7116: 7114: 7111: 7109: 7106: 7104: 7101: 7099: 7096: 7094: 7091: 7089: 7086: 7085: 7084: 7081: 7080: 7079: 7078:Sp/KLF family 7076: 7072: 7069: 7067: 7064: 7063: 7062: 7059: 7055: 7052: 7050: 7047: 7045: 7042: 7041: 7040: 7037: 7033: 7030: 7028: 7025: 7023: 7020: 7019: 7018: 7015: 7011: 7008: 7006: 7003: 7002: 7001: 6998: 6994: 6991: 6989: 6986: 6984: 6981: 6979: 6976: 6974: 6971: 6969: 6966: 6964: 6961: 6960: 6959: 6956: 6954: 6951: 6949: 6946: 6942: 6939: 6937: 6934: 6932: 6929: 6927: 6924: 6923: 6922: 6919: 6917: 6914: 6912: 6909: 6905: 6902: 6900: 6897: 6895: 6892: 6891: 6890: 6889: 6885: 6883: 6880: 6879: 6872: 6869: 6867: 6864: 6862: 6859: 6857: 6854: 6852: 6849: 6847: 6844: 6842: 6839: 6837: 6834: 6833: 6832: 6829: 6827: 6824: 6822: 6819: 6815: 6812: 6810: 6807: 6806: 6805: 6802: 6800: 6797: 6795: 6792: 6790: 6787: 6786: 6785: 6782: 6781: 6779: 6777: 6766: 6760: 6757: 6753: 6750: 6748: 6745: 6743: 6740: 6739: 6738: 6735: 6731: 6728: 6726: 6723: 6721: 6718: 6716: 6713: 6711: 6708: 6706: 6703: 6702: 6701: 6698: 6697: 6695: 6693: 6686: 6676: 6673: 6671: 6668: 6667: 6665: 6662: 6657: 6651: 6648: 6647: 6645: 6642: 6637: 6631: 6628: 6626: 6623: 6622: 6620: 6617: 6612: 6604: 6601: 6599: 6596: 6594: 6591: 6590: 6589: 6586: 6585: 6583: 6580: 6575: 6567: 6564: 6562: 6559: 6557: 6554: 6553: 6552: 6549: 6545: 6542: 6540: 6537: 6535: 6532: 6528: 6525: 6523: 6520: 6519: 6518: 6515: 6513: 6510: 6509: 6508: 6505: 6504: 6502: 6499: 6494: 6488: 6485: 6481: 6478: 6476: 6473: 6472: 6471: 6468: 6464: 6461: 6459: 6456: 6454: 6451: 6450: 6449: 6446: 6444: 6441: 6437: 6434: 6432: 6429: 6428: 6427: 6424: 6422: 6419: 6415: 6412: 6410: 6406: 6405: 6404: 6401: 6400: 6398: 6395: 6390: 6384: 6381: 6377: 6374: 6372: 6369: 6368: 6367: 6364: 6360: 6357: 6355: 6352: 6350: 6347: 6346: 6345: 6342: 6338: 6335: 6333: 6330: 6328: 6325: 6324: 6323: 6320: 6318: 6315: 6311: 6308: 6306: 6303: 6301: 6298: 6297: 6296: 6293: 6289: 6286: 6284: 6281: 6280: 6279: 6276: 6274: 6271: 6269: 6266: 6262: 6259: 6257: 6254: 6253: 6252: 6249: 6248: 6246: 6243: 6238: 6235: 6233: 6226: 6223: 6219: 6215: 6210: 6207: 6202: 6198: 6182: 6179: 6177: 6174: 6172: 6169: 6167: 6164: 6162: 6159: 6158: 6157: 6154: 6153: 6151: 6149: 6145: 6137: 6134: 6132: 6129: 6127: 6124: 6122: 6119: 6117: 6114: 6112: 6109: 6107: 6104: 6103: 6102: 6099: 6098: 6096: 6094: 6090: 6081: 6078: 6074: 6071: 6069: 6066: 6065: 6064: 6061: 6057: 6054: 6052: 6049: 6047: 6044: 6042: 6039: 6037: 6034: 6033: 6032: 6029: 6028: 6027: 6024: 6020: 6017: 6015: 6012: 6010: 6007: 6005: 6002: 6001: 6000: 5997: 5996: 5994: 5992: 5988: 5982: 5979: 5975: 5972: 5970: 5967: 5966: 5965: 5962: 5960: 5957: 5955: 5952: 5950: 5947: 5945: 5942: 5940: 5937: 5935: 5932: 5928: 5925: 5923: 5920: 5919: 5918: 5915: 5913: 5910: 5909: 5907: 5905: 5902: 5898: 5888: 5885: 5884: 5882: 5874: 5866: 5863: 5861: 5858: 5856: 5853: 5852: 5851: 5848: 5844: 5841: 5839: 5836: 5834: 5831: 5829: 5826: 5824: 5821: 5819: 5816: 5814: 5811: 5810: 5809: 5806: 5805: 5803: 5797: 5789: 5786: 5784: 5781: 5779: 5776: 5774: 5771: 5770: 5769: 5766: 5764: 5761: 5757: 5754: 5752: 5749: 5747: 5744: 5743: 5742: 5739: 5738: 5736: 5730: 5722: 5719: 5717: 5714: 5713: 5712: 5709: 5705: 5702: 5700: 5697: 5695: 5692: 5690: 5687: 5686: 5685: 5682: 5678: 5675: 5673: 5670: 5668: 5665: 5664: 5662: 5658: 5655: 5653: 5650: 5648: 5645: 5644: 5643: 5640: 5638: 5635: 5631: 5628: 5626: 5623: 5622: 5621: 5618: 5616: 5613: 5611: 5608: 5607: 5605: 5602: 5594: 5588: 5585: 5583: 5580: 5576: 5573: 5571: 5568: 5566: 5563: 5562: 5561: 5558: 5556: 5553: 5552: 5550: 5544: 5538: 5535: 5529: 5526: 5524: 5521: 5520: 5519: 5516: 5514: 5511: 5510: 5509: 5506: 5502: 5499: 5497: 5494: 5493: 5492: 5489: 5485: 5482: 5480: 5477: 5476: 5475: 5472: 5468: 5465: 5463: 5460: 5458: 5455: 5454: 5453: 5450: 5446: 5443: 5441: 5438: 5437: 5436: 5433: 5429: 5426: 5424: 5421: 5419: 5416: 5414: 5411: 5410: 5409: 5406: 5404: 5401: 5397: 5394: 5392: 5389: 5388: 5387: 5384: 5382: 5379: 5375: 5372: 5370: 5367: 5366: 5365: 5362: 5361: 5359: 5353: 5350: 5347: 5343: 5339: 5333: 5330: 5326: 5323: 5321: 5318: 5316: 5313: 5312: 5311: 5308: 5306: 5303: 5301: 5298: 5294: 5291: 5289: 5286: 5284: 5281: 5279: 5276: 5275: 5274: 5271: 5267: 5264: 5262: 5259: 5257: 5254: 5252: 5249: 5248: 5247: 5244: 5242: 5239: 5237: 5234: 5232: 5229: 5227: 5224: 5222: 5219: 5217: 5214: 5210: 5207: 5205: 5202: 5200: 5197: 5196: 5195: 5192: 5188: 5185: 5183: 5180: 5178: 5175: 5173: 5170: 5168: 5165: 5163: 5160: 5159: 5158: 5155: 5153: 5150: 5148: 5145: 5141: 5138: 5136: 5133: 5132: 5131: 5128: 5124: 5121: 5119: 5116: 5114: 5111: 5109: 5106: 5104: 5101: 5099: 5096: 5094: 5091: 5089: 5086: 5085: 5084: 5081: 5077: 5074: 5072: 5069: 5067: 5064: 5062: 5059: 5057: 5054: 5052: 5049: 5047: 5044: 5042: 5039: 5038: 5037: 5034: 5033: 5031: 5028: 5024: 5021: 5017: 5013: 5009: 5004: 5000: 4996: 4992: 4985: 4980: 4978: 4973: 4971: 4966: 4965: 4962: 4957: 4953: 4949: 4941: 4937: 4934: 4932: 4928: 4925: 4923: 4919: 4916: 4913: 4911: 4908: 4907: 4903: 4896: 4892: 4888: 4884: 4880: 4876: 4871: 4867: 4861: 4857: 4852: 4851: 4844: 4840: 4834: 4829: 4828: 4821: 4820: 4815: 4807: 4803: 4799: 4795: 4791: 4787: 4783: 4779: 4772: 4769: 4764: 4760: 4756: 4752: 4748: 4744: 4740: 4736: 4729: 4726: 4721: 4717: 4712: 4707: 4702: 4697: 4693: 4689: 4685: 4678: 4676: 4674: 4672: 4670: 4666: 4661: 4657: 4653: 4649: 4645: 4641: 4637: 4633: 4626: 4623: 4618: 4614: 4609: 4604: 4600: 4596: 4592: 4588: 4584: 4577: 4574: 4569: 4565: 4561: 4557: 4553: 4549: 4542: 4539: 4527: 4523: 4519: 4515: 4511: 4507: 4503: 4500:(5): 719–22. 4499: 4495: 4491: 4484: 4481: 4476: 4472: 4468: 4464: 4460: 4456: 4452: 4448: 4441: 4438: 4433: 4429: 4424: 4419: 4415: 4411: 4407: 4400: 4397: 4392: 4388: 4383: 4378: 4374: 4370: 4367:(6): 626–32. 4366: 4362: 4358: 4351: 4348: 4343: 4339: 4334: 4329: 4325: 4321: 4318:(4): 185–95. 4317: 4313: 4309: 4302: 4300: 4296: 4291: 4287: 4283: 4279: 4276:(4): 240–52. 4275: 4271: 4264: 4261: 4256: 4252: 4247: 4242: 4238: 4234: 4230: 4223: 4220: 4215: 4211: 4206: 4201: 4197: 4193: 4189: 4185: 4181: 4174: 4171: 4166: 4162: 4157: 4152: 4148: 4144: 4140: 4133: 4130: 4125: 4121: 4116: 4111: 4107: 4103: 4100:(2): 343–51. 4099: 4095: 4091: 4084: 4081: 4076: 4072: 4067: 4062: 4059:(6): 4862–8. 4058: 4054: 4050: 4043: 4040: 4035: 4031: 4026: 4021: 4017: 4013: 4010:(1): 257–64. 4009: 4005: 4001: 3994: 3991: 3986: 3982: 3977: 3972: 3968: 3964: 3960: 3956: 3952: 3945: 3942: 3937: 3933: 3928: 3923: 3919: 3915: 3912:(7): 1562–9. 3911: 3907: 3903: 3896: 3893: 3888: 3884: 3879: 3874: 3870: 3866: 3862: 3855: 3852: 3847: 3843: 3839: 3835: 3831: 3827: 3823: 3819: 3812: 3809: 3804: 3800: 3796: 3792: 3788: 3784: 3777: 3774: 3769: 3765: 3761: 3757: 3753: 3749: 3745: 3741: 3737: 3733: 3726: 3723: 3718: 3714: 3710: 3706: 3702: 3698: 3695:(2): 409–14. 3694: 3690: 3682: 3679: 3674: 3670: 3666: 3662: 3657: 3652: 3648: 3644: 3640: 3636: 3632: 3625: 3622: 3617: 3613: 3608: 3603: 3598: 3593: 3589: 3585: 3581: 3574: 3571: 3566: 3562: 3558: 3554: 3550: 3546: 3542: 3538: 3531: 3528: 3523: 3519: 3514: 3509: 3505: 3501: 3497: 3493: 3489: 3482: 3480: 3476: 3471: 3467: 3463: 3459: 3455: 3451: 3447: 3443: 3436: 3433: 3428: 3424: 3419: 3414: 3409: 3404: 3400: 3396: 3392: 3388: 3384: 3377: 3374: 3369: 3365: 3360: 3355: 3351: 3347: 3342: 3337: 3333: 3329: 3325: 3321: 3317: 3310: 3307: 3295: 3291: 3285: 3281: 3280: 3275: 3268: 3265: 3260: 3256: 3252: 3248: 3244: 3240: 3237:(8): 811–23. 3236: 3232: 3225: 3222: 3217: 3213: 3208: 3203: 3199: 3195: 3192:(7): 1562–9. 3191: 3187: 3183: 3176: 3173: 3168: 3164: 3159: 3154: 3150: 3146: 3142: 3138: 3134: 3127: 3124: 3111: 3107: 3103: 3097: 3094: 3082: 3075: 3068: 3065: 3053: 3049: 3045: 3041: 3037: 3033: 3029: 3025: 3021: 3017: 3010: 3007: 3002: 2998: 2994: 2990: 2986: 2982: 2978: 2974: 2966: 2963: 2958: 2954: 2949: 2944: 2939: 2934: 2930: 2926: 2922: 2918: 2914: 2907: 2904: 2899: 2895: 2891: 2887: 2883: 2879: 2875: 2871: 2867: 2863: 2856: 2853: 2841: 2837: 2833: 2827: 2824: 2819: 2815: 2810: 2805: 2801: 2797: 2793: 2789: 2785: 2778: 2775: 2770: 2766: 2762: 2758: 2754: 2750: 2743: 2740: 2735: 2731: 2727: 2723: 2719: 2715: 2708: 2706: 2702: 2696: 2693: 2682:on 2019-12-21 2681: 2677: 2673: 2667: 2664: 2659: 2655: 2651: 2647: 2643: 2639: 2632: 2629: 2624: 2620: 2616: 2612: 2609:(8): 277–80. 2608: 2604: 2597: 2595: 2591: 2586: 2582: 2577: 2572: 2568: 2564: 2560: 2556: 2552: 2545: 2543: 2541: 2537: 2532: 2528: 2524: 2520: 2516: 2512: 2505: 2501: 2495: 2492: 2486: 2482: 2479: 2477: 2474: 2473: 2469: 2459: 2456: 2450: 2447: 2443: 2437: 2434: 2428: 2425: 2419: 2416: 2410: 2407: 2398: 2394: 2390: 2386: 2382: 2378: 2374: 2370: 2366: 2362: 2358: 2354: 2350: 2346: 2342: 2338: 2337: 2335: 2331: 2327: 2323: 2319: 2315: 2311: 2307: 2303: 2299: 2295: 2291: 2287: 2283: 2279: 2275: 2271: 2267: 2263: 2259: 2255: 2251: 2247: 2243: 2239: 2235: 2231: 2227: 2223: 2221: 2217: 2213: 2209: 2205: 2201: 2197: 2193: 2189: 2185: 2181: 2177: 2173: 2169: 2165: 2161: 2157: 2153: 2149: 2145: 2141: 2137: 2133: 2129: 2125: 2121: 2117: 2113: 2109: 2105: 2101: 2097: 2093: 2089: 2085: 2081: 2077: 2073: 2069: 2065: 2061: 2057: 2053: 2049: 2045: 2041: 2037: 2033: 2029: 2025: 2021: 2017: 2013: 2009: 2005: 2001: 1997: 1994: 1990: 1986: 1982: 1978: 1974: 1970: 1966: 1962: 1958: 1954: 1950: 1946: 1943: 1939: 1935: 1931: 1927: 1923: 1919: 1915: 1913: 1909: 1905: 1901: 1897: 1893: 1889: 1886: 1882: 1878: 1874: 1871: 1867: 1863: 1859: 1855: 1851: 1849: 1845: 1841: 1837: 1833: 1829: 1825: 1821: 1817: 1813: 1809: 1805: 1801: 1797: 1793: 1789: 1785: 1781: 1777: 1775: 1771: 1767: 1763: 1759: 1755: 1751: 1747: 1743: 1739: 1735: 1731: 1727: 1726: 1725: 1722: 1720: 1716: 1712: 1708: 1704: 1700: 1696: 1692: 1688: 1684: 1680: 1676: 1672: 1668: 1664: 1660: 1656: 1652: 1648: 1644: 1639: 1637: 1633: 1629: 1625: 1621: 1617: 1613: 1608: 1606: 1602: 1598: 1594: 1590: 1586: 1582: 1578: 1574: 1570: 1566: 1562: 1558: 1554: 1546: 1542: 1538: 1534: 1530: 1526: 1522: 1518: 1514: 1511: 1509: 1506: 1504: 1503: 1498: 1497: 1494: 1490: 1486: 1482: 1478: 1474: 1470: 1466: 1462: 1459: 1457: 1456:chromosome 12 1454: 1452: 1451: 1446: 1445: 1442: 1438: 1434: 1430: 1426: 1422: 1418: 1414: 1410: 1406: 1403: 1401: 1400:chromosome 17 1398: 1396: 1395: 1390: 1389: 1386: 1382: 1378: 1374: 1370: 1366: 1362: 1358: 1354: 1350: 1346: 1343: 1341: 1338: 1336: 1335: 1330: 1329: 1326: 1323: 1321: 1320: 1316: 1314: 1311: 1310: 1307: 1301: 1299: 1292: 1290: 1288: 1284: 1279: 1274: 1270: 1264: 1256: 1254: 1252: 1248: 1244: 1240: 1236: 1229: 1221: 1219: 1214: 1206: 1204: 1201: 1196: 1192: 1188: 1184: 1179: 1177: 1173: 1169: 1168: 1163: 1159: 1154: 1151: 1147: 1146: 1141: 1135: 1127: 1122: 1115: 1110: 1108: 1105: 1101: 1097: 1093: 1084: 1082: 1080: 1076: 1072: 1064: 1062: 1060: 1056: 1052: 1048: 1044: 1039: 1035: 1028: 1026: 1024: 1020: 1016: 1012: 1008: 1004: 999: 991: 989: 987: 982: 979: 975: 971: 967: 962: 954: 952: 949: 945: 941: 937: 933: 929: 925: 920: 918: 914: 910: 906: 902: 898: 894: 890: 889:alpha helices 886: 877: 869: 867: 863: 859: 851: 849: 847: 843: 839: 835: 831: 827: 823: 819: 815: 811: 807: 803: 799: 795: 791: 790: 785: 784: 775: 771: 767: 760: 758: 756: 752: 749: 745: 741: 737: 733: 729: 725: 722: 718: 714: 710: 707: 703: 699: 695: 691: 687: 686:morphogenesis 683: 678: 676: 673:, around 180 672: 668: 653: 647: 641: 635: 629: 623: 617: 611: 605: 599: 593: 587: 581: 575: 569: 563: 557: 551: 545: 539: 533: 527: 521: 515: 509: 503: 497: 491: 485: 479: 473: 467: 461: 455: 449: 443: 437: 431: 425: 419: 413: 407: 401: 395: 389: 383: 377: 371: 365: 359: 353: 347: 341: 335: 329: 323: 317: 311: 305: 299: 293: 287: 281: 275: 269: 263: 257: 251: 245: 239: 233: 227: 223: 221: 217: 214: 211: 209: 205: 202: 198: 194: 191: 189: 185: 181: 177: 174: 171: 167: 162: 158: 155: 151: 147: 144: 142: 138: 135: 132: 130: 126: 123: 120: 118: 114: 111: 108: 106: 102: 99: 96: 93: 89: 86: 83: 81: 77: 73: 69: 64: 59: 55: 54: 49: 43: 38: 33: 30: 19: 10879: 10772:eyeless gene 10730: 10668:Evolvability 10642:Segmentation 10519:Canalisation 10489:Heterochrony 10479:Heritability 10447:Key concepts 10391: 10346: 10302: 10260: 10252: 10224: 10218: 10212: 10181: 10146: 10134: 10071: 10048: 10030: 9998: 9969: 9850: 9780: 9754: 9706: 9609: 9556: 9476: 9464: 9418: 9410: 9316: 9262: 9235: 9227: 9198: 9187: 8931:FOX proteins 8891:winged helix 8883: 8854: 8837: 8780: 8700: 8674: 8552: 8518: 8501: 8479: 8462: 8395: 8363: 8217: 8180: 8161: 8107: 8073: 8067: 7849: 7761: 7755: 7744: 7738:Antennapedia 7736: 7723: 7711: 7705: 7674: 7632: 7610: 7587: 7566: 7324: 7277: 7223: 7169: 7082: 7060: 7038: 7016: 6999: 6957: 6886: 6768: 6736: 6688: 6660: 6640: 6615: 6578: 6544:Progesterone 6497: 6393: 6241: 6227: 6221: 6205: 6147: 6100: 6092: 5990: 5900: 5849: 5807: 5767: 5740: 5710: 5683: 5517: 5507: 5490: 5473: 5385: 5341: 5309: 5272: 5129: 5019: 5007: 4931:LIG_HOMEOBOX 4929:motif class 4878: 4874: 4849: 4826: 4781: 4777: 4771: 4738: 4734: 4728: 4691: 4687: 4638:(3): 212–9. 4635: 4631: 4625: 4590: 4586: 4576: 4551: 4547: 4541: 4530:. Retrieved 4497: 4493: 4483: 4450: 4446: 4440: 4413: 4409: 4399: 4364: 4360: 4350: 4315: 4311: 4273: 4269: 4263: 4236: 4232: 4222: 4187: 4183: 4173: 4146: 4142: 4132: 4097: 4093: 4083: 4056: 4052: 4042: 4007: 4003: 3993: 3958: 3954: 3944: 3909: 3905: 3895: 3868: 3864: 3854: 3824:(1): 19–25. 3821: 3817: 3811: 3786: 3782: 3776: 3735: 3731: 3725: 3692: 3688: 3681: 3638: 3634: 3624: 3587: 3583: 3573: 3543:(1): 31–45. 3540: 3536: 3530: 3495: 3491: 3445: 3441: 3435: 3390: 3386: 3376: 3323: 3319: 3309: 3298:. Retrieved 3278: 3267: 3234: 3230: 3224: 3189: 3185: 3175: 3140: 3136: 3126: 3114:. Retrieved 3110:the original 3105: 3096: 3085:. Retrieved 3072:Bürglin TR. 3067: 3056:. Retrieved 3026:(2): 403–8. 3023: 3019: 3009: 2976: 2972: 2965: 2920: 2916: 2906: 2865: 2861: 2855: 2844:. Retrieved 2835: 2826: 2791: 2787: 2777: 2755:(1): 25–48. 2752: 2748: 2742: 2717: 2713: 2695: 2684:. Retrieved 2680:the original 2675: 2672:"Homeoboxes" 2666: 2641: 2637: 2631: 2606: 2602: 2558: 2554: 2514: 2510: 2494: 2458: 2449: 2436: 2427: 2418: 2409: 1890:SINE-class: 1852:CERS-class: 1723: 1640: 1609: 1551: 1508:chromosome 2 1500: 1448: 1392: 1340:chromosome 7 1332: 1324: 1317: 1312: 1305: 1296: 1287:lambda phage 1266: 1235:segmentation 1231: 1216: 1191:angiogenesis 1180: 1175: 1167:Antennapedia 1165: 1155: 1143: 1137: 1125: 1088: 1074: 1068: 1041:inhibitory. 1032: 1023:pluripotency 995: 958: 928:lambda phage 921: 919:of the DNA. 917:major groove 897:antiparallel 882: 858:protein fold 855: 842:phylogenetic 802:antennapedia 801: 797: 794:antennapedia 793: 789:antennapedia 787: 781: 779: 774:antennapedia 773: 769: 747: 736:antennapedia 726: 717:protein fold 705: 679: 671:DNA sequence 666: 664: 51: 48:Antennapedia 29: 10870:Mike Levine 10779:Distal-less 10604:Polyphenism 10584:Epigenetics 10436:development 10072:(4.11) Runt 7727:Homeodomain 7325:zinc finger 6661:subfamily 0 6641:subfamily 6 6616:subfamily 5 6579:subfamily 4 6498:subfamily 3 6394:subfamily 2 6242:subfamily 1 6209:Zinc finger 5452:Neurogenins 5020:(1.1) Basic 4688:BMC Biology 4548:Development 3783:Development 3393:(1): e153. 2224:NKL-class: 1998:PRD-class: 1916:CUT-class: 1875:HNF-class: 1778:POU-class: 1728:LIM-class: 1195:endothelial 1061:structure. 981:hydrophobic 932:prokaryotes 915:within the 909:side chains 834:Bloomington 822:Switzerland 755:vertebrates 706:homeodomain 74:Homeodomain 66:Identifiers 35:Homeodomain 10929:Categories 10848:Lac operon 10673:Robustness 10652:Modularity 10647:Metamerism 10553:Plasticity 10548:Pleiotropy 10501:Heterotopy 8605:POU domain 7745:ANTP class 7675:(2.6) WRKY 6958:GLI family 6093:(1.5) RF-X 5991:(1.4) NF-1 4532:2019-12-11 3961:: 167–76. 3607:10023/8685 3300:2008-02-27 3087:2010-01-30 3058:2019-12-09 2846:2019-12-09 2686:2019-11-20 2555:Chromosoma 2487:References 1947:ZF-class: 1319:chromosome 1263:POU family 1213:LIM domain 1200:hemangioma 1176:Drosophila 1075:Drosophila 1071:phenotypic 1043:Drosophila 1029:Regulation 924:eukaryotes 901:C-terminal 893:N-terminal 862:amino acid 846:bilaterian 798:Drosophila 783:Drosophila 770:Drosophila 748:Drosophila 702:eukaryotes 675:base pairs 176:structures 10799:Morphogen 10784:Engrailed 10767:Pax genes 10688:Tinkering 10534:Epistasis 10529:Dominance 10440:phenotype 10392:see also 10233:Apetala 2 8887:Fork head 7567:(2.4) Cys 6769:(2.3) Cys 5501:Scleraxis 4956:IPR001356 4694:(1): 47. 3616:2296-701X 2507:​; 2481:Body plan 2442:Pax genes 2002:(CART1), 1257:POU genes 1228:Pax genes 1222:Pax genes 1207:LIM genes 1116:Hox genes 1100:Paleozoic 1085:Evolution 1079:evolution 1065:Mutations 1059:chromatin 1051:trithorax 1038:microRNAs 1034:Hox genes 978:Conserved 866:consensus 848:animals. 772:with the 761:Discovery 649:​, 643:​, 637:​, 631:​, 625:​, 619:​, 613:​, 607:​, 601:​, 595:​, 589:​, 583:​, 577:​, 571:​, 565:​, 559:​, 553:​, 547:​, 541:​, 535:​, 529:​, 523:​, 517:​, 511:​, 505:​, 499:​, 493:​, 487:​, 481:​, 475:​, 469:​, 463:​, 457:​, 451:​, 445:​, 439:​, 433:​, 427:​, 421:​, 415:​, 409:​, 403:​, 397:​, 391:​, 385:​, 379:​, 373:​, 367:​, 361:​, 355:​, 349:​, 343:​, 337:​, 331:​, 325:​, 319:​, 313:​, 307:​, 301:​, 295:​, 289:​, 283:​, 277:​, 271:​, 265:​, 259:​, 253:​, 247:​, 241:​, 235:​, 229:​, 134:PDOC00027 110:IPR001356 10762:Hox gene 10750:Elements 10731:Homeobox 9710:MADS box 7850:Homeobox 7762:Hox-like 7756:protoHOX 6517:Estrogen 6512:Androgen 6366:Rev-ErbA 5904:bHLH-ZIP 5879:bHLH-COE 5418:Myogenin 4952:InterPro 4936:Homeobox 4918:Archived 4895:17098381 4806:32619323 4798:16688724 4763:11144283 4720:17963489 4652:17501745 4526:Archived 4522:44613005 4467:15520811 4432:15757903 4391:19458547 4342:19262140 4290:16379594 4255:15914537 4214:12466126 4165:15545924 4124:10648567 4075:14610084 3985:25979369 3936:25953647 3887:11073881 3838:10199961 3717:30114443 3673:17558233 3665:12445403 3565:44396110 3557:23799629 3522:19734295 3470:42823485 3462:16341069 3427:17252055 3387:PLOS ONE 3294:Archived 3259:17159381 3251:24996520 3216:25953647 3116:27 March 3081:Archived 3052:Archived 3048:40456645 3001:30114443 2840:Archived 2734:53188259 2585:26464018 2470:See also 1836:POU5F1P4 1832:POU5F1P1 1247:skeletal 1172:bithorax 1140:metazoan 1134:Hox gene 1096:Bilatera 1092:Cnidaria 1047:polycomb 966:arginine 751:homeotic 728:Homeosis 667:homeobox 193:RCSB PDB 105:InterPro 10893:Debates 10704:Systems 10630:Eyespot 10494:Neoteny 10110:RUNX1T1 10090:CBFA2T3 10085:CBFA2T2 9965:TCF/LEF 8074:NK-like 8068:metaHOX 7771:ParaHox 7712:domains 6403:COUP-TF 5877:Group F 5800:Group E 5733:Group D 5597:Group C 5547:Group B 5491:Paraxis 5356:Group A 4743:Bibcode 4711:2211742 4660:9530210 4617:9336443 4568:1687460 4514:1591773 4475:6030950 4382:2728585 4333:2634105 4205:1850921 4115:2174277 4034:9314544 4025:2139816 3976:4592147 3927:4754957 3846:3192774 3803:8898214 3768:4320668 3760:3821869 3740:Bibcode 3709:6327066 3643:Bibcode 3513:2775110 3418:1779807 3395:Bibcode 3368:9391098 3328:Bibcode 3207:4754957 3167:1357628 3040:6327065 2993:6327066 2957:6330741 2925:Bibcode 2898:4235713 2890:6323992 2870:Bibcode 2818:6416827 2769:2568852 2720:: 3–6. 2658:7903947 2623:1357790 2576:4901127 2531:7903398 2038:, DUX ( 1926:ONECUT3 1922:ONECUT2 1918:ONECUT1 1719:TGIF2LY 1715:TGIF2LX 1553:ParaHox 1499:HOXD - 1447:HOXC - 1391:HOXB - 1183:paralog 1162:ectopia 1145:Xenopus 1011:tissues 944:glycine 816:of the 744:animals 709:protein 690:animals 655:​ 129:PROSITE 122:SM00389 85:PF00046 10794:Ligand 10474:Operon 8823:Bicoid 8088:BARHL2 8083:BARHL1 7665:JMJD1B 7578:HIVEP1 6063:I-SMAD 6031:R-SMAD 5949:MLXIPL 5704:Period 5630:ARNTL2 5435:NeuroD 4942:(MeSH) 4893:  4862:  4835:  4804:  4796:  4761:  4718:  4708:  4658:  4650:  4615:  4608:147054 4605:  4566:  4520:  4512:  4473:  4465:  4430:  4389:  4379:  4340:  4330:  4288:  4253:  4212:  4202:  4163:  4122:  4112:  4073:  4032:  4022:  3983:  3973:  3934:  3924:  3885:  3844:  3836:  3801:  3766:  3758:  3732:Nature 3715:  3707:  3671:  3663:  3614:  3563:  3555:  3520:  3510:  3468:  3460:  3425:  3415:  3366:  3356:  3348:  3286:  3257:  3249:  3214:  3204:  3165:  3158:334173 3155:  3046:  3038:  2999:  2991:  2955:  2948:345379 2945:  2896:  2888:  2862:Nature 2816:  2809:555405 2806:  2767:  2732:  2656:  2621:  2583:  2573:  2529:  2397:NKX6-3 2393:NKX6-2 2389:NKX6-1 2373:NKX2-6 2369:NKX2-5 2365:NKX2-3 2361:NKX3-2 2357:NKX3-1 2353:NKX2-8 2349:NKX2-2 2345:NKX2-4 2341:NKX2-1 2339:Nkx: 2230:BARHL2 2226:BARHL1 2188:RHOXF2 2184:RHOXF1 2148:PHOX2B 2144:PHOX2A 1877:HMBOX1 1848:POU6F2 1846:; and 1844:POU6F1 1840:POU5F2 1828:POU5F1 1824:POU4F3 1820:POU4F2 1816:POU4F1 1812:POU3F4 1808:POU3F3 1804:POU3F2 1800:POU3F1 1796:POU2F3 1792:POU2F2 1788:POU2F1 1784:POU1F1 1703:PKNOX2 1699:PKNOX1 1634:, and 1603:; and 1575:; and 1545:HOXD13 1541:HOXD12 1537:HOXD11 1533:HOXD10 1493:HOXC13 1489:HOXC12 1485:HOXC11 1481:HOXC10 1441:HOXB13 1385:HOXA13 1381:HOXA11 1377:HOXA10 1015:organs 970:lysine 948:steric 812:, and 698:plants 208:PDBsum 182:  172:  154:SUPFAM 98:CL0123 71:Symbol 10935:Genes 10373:Sigma 10238:EREBP 10222:EREBP 10213:(0.5) 10182:(0.3) 10105:RUNX3 10100:RUNX2 10095:RUNX1 10039:TFCP2 9960:SSRP1 9781:(4.7) 9771:TBPL1 9755:(4.6) 9707:(4.4) 9557:(4.2) 9498:NFKB2 9493:NFKB1 9488:NF-κB 9477:(4.1) 9401:MYBL2 9188:(3.4) 8884:(3.3) 8833:BICD2 8808:SHOX2 8776:PROP1 8760:PRRX 8670:SATB2 8615:BRN-3 8610:PIT-1 8502:PKNOX 8417:TALE 8413:NOBOX 8386:HESX1 8359:CUTL1 8341:other 8235:NANOG 8098:BARX2 8093:BARX1 7845:MEOX2 7840:MEOX1 7724:(3.1) 7633:JARID 7606:GRLF1 7601:DIDO1 7261:Zbtb7 7251:TSHZ3 7219:PRDM9 7017:HIVEP 6882:ATBF1 6836:TFIIH 6821:TFIIF 6804:TFIIE 6799:TFIID 6794:TFIIB 6789:TFIIA 6759:TRPS1 6625:LRH-1 6603:NURR1 6593:NGFIB 6421:Ear-2 6222:(2.1) 5964:SREBP 5901:(1.3) 5663:NPAS 5652:EPAS1 5637:CLOCK 5625:ARNTL 5599:bHLH- 5575:n-Myc 5570:l-Myc 5565:c-Myc 5555:FIGLA 5537:Twist 5496:TCF15 5403:MESP2 5381:ATOH1 5374:ASCL2 5369:ASCL1 5300:NFIL3 5231:GABPA 5226:DDIT3 5157:C/EBP 5152:BLZF1 5113:c-Jun 5103:FOSL2 5098:FOSL1 5088:c-Fos 4858:–66. 4802:S2CID 4656:S2CID 4518:S2CID 4471:S2CID 3842:S2CID 3764:S2CID 3713:S2CID 3669:S2CID 3561:S2CID 3466:S2CID 3359:28378 3350:43805 3346:JSTOR 3255:S2CID 3077:(gif) 3044:S2CID 2997:S2CID 2894:S2CID 2730:S2CID 2334:VENTX 2322:TSHZ3 2318:TSHZ2 2314:TSHZ1 2294:NANOG 2238:BARX2 2234:BARX1 2208:TPRX1 2204:SHOX2 2196:SEBOX 2172:PRRX2 2168:PRRX1 2164:PROP1 2160:PITX3 2156:PITX2 2152:PITX1 2096:NOBOX 2092:MIXL1 2088:LEUTX 2076:HESX1 2020:DMBX1 2012:ARGFX 1993:HOMEZ 1985:ZFHX4 1981:ZFHX3 1977:ZFHX2 1965:TSHZ3 1961:TSHZ2 1957:TSHZ1 1953:ADNP2 1942:SATB2 1938:SATB1 1885:HNF1B 1881:HNF1A 1870:LASS6 1866:LASS5 1862:LASS4 1858:LASS3 1854:LASS2 1774:LMX1B 1770:LMX1A 1711:TGIF2 1707:TGIF1 1675:MEIS3 1671:MEIS2 1667:MEIS1 1601:MEOX2 1597:MEOX1 1529:HOXD9 1525:HOXD8 1521:HOXD4 1517:HOXD3 1513:HOXD1 1502:HOXD@ 1477:HOXC9 1473:HOXC8 1469:HOXC6 1465:HOXC5 1461:HOXC4 1450:HOXC@ 1437:HOXB9 1433:HOXB8 1429:HOXB7 1425:HOXB6 1421:HOXB5 1417:HOXB4 1413:HOXB3 1409:HOXB2 1405:HOXB1 1394:HOXB@ 1373:HOXA9 1369:HOXA7 1365:HOXA6 1361:HOXA5 1357:HOXA4 1353:HOXA3 1349:HOXA2 1345:HOXA1 1334:HOXA@ 1251:Pax 6 1019:NANOG 961:B-DNA 913:bases 694:fungi 688:) in 682:genes 669:is a 150:SCOPe 141:SCOP2 117:SMART 10434:The 10342:MNDA 10261:ARID 10216:AP-2 10203:RBL2 10198:RBL1 10172:HBP1 10155:HMGA 10062:YBX1 10057:CSDA 9992:LEF1 9824:HMGN 9797:HMGB 9718:Mef2 9697:MYRF 9685:TBR2 9680:TBR1 9628:TP63 9568:STAT 9560:STAT 9520:NFAT 9513:RELB 9508:RELA 9463:(4) 9344:FLI1 9310:SPIB 9011:D4L6 9006:D4L5 9001:D4L4 8996:D4L3 8991:D4L1 8855:PITX 8818:VSX2 8813:VSX1 8803:SHOX 8781:PHOX 8463:MEIS 8391:HOPX 8327:VAX2 8322:VAX1 8317:TLX3 8312:TLX2 8307:TLX1 8302:NATO 8285:HMX3 8280:HMX2 8275:HMX1 8213:LBX2 8208:LBX1 8198:HHEX 8057:MNX1 8052:GBX2 8047:GBX1 7835:Evx2 7830:Evx1 7798:PDX1 7793:Xlox 7683:WRKY 7596:AIRE 7555:804A 7278:ZBTB 7224:SALL 7214:OSR1 7209:MYT1 7204:MTF1 7039:IKZF 6978:REST 6953:GFI1 6948:ERV3 6916:E4F1 6911:CTCF 6700:GATA 6670:DAX1 6650:GCNF 6598:NOR1 6426:HNF4 6295:PPAR 6228:(Cys 6156:AP-2 6026:SMAD 5981:USF1 5954:MXI1 5934:MITF 5927:MXD3 5922:MXD1 5912:AP-4 5887:EBF1 5763:Pho4 5741:BHLH 5620:ARNT 5615:AHRR 5587:TCF4 5582:MXD4 5513:LYL1 5474:OLIG 5428:MYF6 5423:MYF5 5413:MyoD 5386:HAND 5364:AS-C 5346:bHLH 5332:XBP1 5236:GCN4 5216:CREM 5194:CREB 5147:BATF 5130:BACH 5123:JunD 5118:JUNB 5108:JDP2 5093:FOSB 5083:AP-1 5041:AATF 5027:bZIP 4993:and 4950:and 4948:Pfam 4891:PMID 4875:Gene 4860:ISBN 4833:ISBN 4794:PMID 4759:PMID 4716:PMID 4648:PMID 4613:PMID 4564:PMID 4510:PMID 4494:Cell 4463:PMID 4428:PMID 4387:PMID 4338:PMID 4286:PMID 4251:PMID 4210:PMID 4161:PMID 4120:PMID 4071:PMID 4030:PMID 3981:PMID 3932:PMID 3883:PMID 3834:PMID 3799:PMID 3756:PMID 3705:PMID 3689:Cell 3661:PMID 3612:ISSN 3553:PMID 3518:PMID 3458:PMID 3423:PMID 3364:PMID 3284:ISBN 3247:PMID 3212:PMID 3163:PMID 3118:2018 3036:PMID 3020:Cell 2989:PMID 2973:Cell 2953:PMID 2886:PMID 2814:PMID 2765:PMID 2654:PMID 2638:Gene 2619:PMID 2581:PMID 2527:PMID 2504:1AHD 2462:Nk5. 2453:Nk4. 2440:The 2385:HMX3 2381:HMX2 2377:HMX1 2330:VAX2 2326:VAX1 2310:TLX3 2306:TLX2 2302:TLX1 2298:NOTO 2290:MSX2 2286:MSX1 2282:LBX2 2278:LBX1 2274:HLX1 2270:HHEX 2258:EMX2 2254:EMX1 2250:DBX2 2246:DBX1 2220:VSX2 2216:VSX1 2212:UNCX 2200:SHOX 2180:RAX2 2140:PAX8 2136:PAX7 2132:PAX6 2128:PAX5 2124:PAX4 2120:PAX3 2116:PAX2 2108:OTX2 2104:OTX1 2080:HOPX 2072:GSC2 2064:ESX1 2036:DUXB 2032:DUXA 2028:DRGX 2024:DPRX 2008:ALX4 2004:ALX3 2000:ALX1 1989:ZHX1 1973:ZEB2 1969:ZEB1 1949:ADNP 1934:CUX2 1930:CUX1 1912:SIX6 1908:SIX5 1904:SIX4 1900:SIX3 1896:SIX2 1892:SIX1 1766:LHX9 1762:LHX8 1758:LHX6 1754:LHX5 1750:LHX4 1746:LHX3 1742:LHX2 1738:LHX1 1734:ISL2 1730:ISL1 1695:PBX4 1691:PBX3 1687:PBX2 1683:PBX1 1663:IRX6 1659:IRX5 1655:IRX4 1651:IRX3 1647:IRX2 1643:IRX1 1636:DLX6 1632:DLX5 1628:DLX4 1624:DLX3 1620:DLX2 1616:DLX1 1605:MNX1 1593:GBX2 1589:GBX1 1585:EVX2 1581:EVX1 1577:PDX1 1573:GSX2 1569:GSX1 1565:CDX4 1561:CDX2 1557:CDX1 1325:gene 1313:name 1187:limb 1170:and 1049:and 1013:and 968:and 938:and 824:and 652:9ant 646:3hdd 640:2r5z 634:2r5y 628:2p81 622:2lfb 616:2jwt 610:2hoa 604:2hi3 598:2hdd 592:2h8r 586:2ecc 580:2ecb 574:2e1o 568:2dmq 562:2cuf 556:2cue 550:2cra 544:2cqx 538:1ztr 532:1zq3 526:1yz8 520:1yrn 514:1x2n 508:1x2m 502:1wi3 496:1vnd 490:1uhs 484:1san 478:1s7e 472:1qry 466:1puf 460:1pog 454:1p7j 448:1p7i 442:1oct 436:1ocp 430:1o4x 424:1nk3 418:1nk2 412:1mnm 406:1mh4 400:1mh3 394:1lfu 388:1lfb 382:1le8 376:1kz2 370:1k61 364:1jgg 358:1ig7 352:1ic8 346:1hom 340:1hf0 334:1hdp 328:1hdd 322:1gt0 316:1ftz 310:1ftt 304:1fjl 298:1f43 292:1enh 286:1e3o 280:1du6 274:1du0 268:1cqt 262:1bw5 256:1b8i 250:1b72 244:1au7 238:1apl 232:1akh 226:1ahd 201:PDBj 197:PDBe 180:ECOD 170:Pfam 146:1ahd 94:clan 92:Pfam 80:Pfam 46:The 10438:of 10369:Rho 10347:NFY 10320:MLL 10303:IFI 10298:CAP 10080:CBF 9999:TOX 9970:TCF 9955:SRY 9868:SOX 9851:HNF 9792:BBX 9766:TBP 9745:SRF 9690:TFT 9640:TBX 9633:p73 9623:p53 9503:REL 9396:MYB 9317:ETV 9305:ERG 9290:ETS 9285:ERF 9263:ELK 9258:EGF 9236:ELF 9200:HSF 8899:E2F 8838:OTX 8828:GSC 8798:RAX 8709:PAX 8675:ZEB 8648:3/4 8598:21A 8553:PHF 8519:SIX 8480:PBX 8456:MKX 8421:IRX 8396:LMX 8364:FHL 8354:CRX 8349:ARX 8295:6-2 8290:6-1 8270:3-2 8265:3-1 8260:2-5 8255:2-3 8250:2-2 8245:2-1 8240:NKX 8218:MSX 8203:HLX 8163:EMX 8125:DLX 8108:DBX 8103:BSX 8040:D13 8035:D12 8030:D11 8025:D10 7995:C13 7990:C12 7985:C11 7980:C10 7950:B13 7900:A13 7895:A11 7890:A10 7805:Cdx 7776:Gsx 7706:(3) 7611:ING 7550:655 7545:649 7540:644 7535:638 7530:593 7525:471 7520:452 7515:451 7510:423 7505:384 7500:366 7495:365 7490:350 7485:346 7480:330 7475:318 7470:300 7465:281 7460:268 7455:267 7450:259 7445:239 7440:238 7435:219 7430:217 7425:202 7420:165 7415:148 7410:146 7405:143 7365:33B 7256:WT1 7083:KLF 7061:ILF 7000:HIC 6993:YY1 6921:EGR 6904:11B 6899:11A 6888:BCL 6871:3C2 6866:3C1 6773:His 6737:MTA 6675:SHP 6630:SF1 6588:NUR 6487:TLX 6448:RXR 6443:PNR 6383:VDR 6344:ROR 6322:RAR 6317:PXR 6305:β/δ 6278:LXR 6273:FXR 6268:CAR 6206:(2) 6136:ANK 6101:RFX 5999:NFI 5959:Myc 5944:MLX 5939:MNT 5917:MAX 5850:HEY 5808:HES 5711:SIM 5684:PER 5642:HIF 5610:AhR 5601:PAS 5560:Myc 5518:TAL 5508:SLC 5310:NRF 5305:NRL 5273:NFE 5246:MAF 5241:HLF 5221:DBP 4883:doi 4879:387 4856:159 4786:doi 4782:140 4751:doi 4739:288 4706:PMC 4696:doi 4640:doi 4603:PMC 4595:doi 4556:doi 4552:113 4502:doi 4455:doi 4418:doi 4414:280 4377:PMC 4369:doi 4328:PMC 4320:doi 4278:doi 4241:doi 4237:118 4200:PMC 4192:doi 4188:161 4151:doi 4110:PMC 4102:doi 4098:148 4061:doi 4057:279 4020:PMC 4012:doi 4008:139 3971:PMC 3963:doi 3922:PMC 3914:doi 3873:doi 3826:doi 3822:296 3791:doi 3787:122 3748:doi 3736:325 3697:doi 3651:doi 3602:hdl 3592:doi 3545:doi 3508:PMC 3500:doi 3450:doi 3413:PMC 3403:doi 3354:PMC 3336:doi 3239:doi 3202:PMC 3194:doi 3153:PMC 3145:doi 3028:doi 2981:doi 2943:PMC 2933:doi 2878:doi 2866:308 2804:PMC 2796:doi 2757:doi 2753:989 2722:doi 2646:doi 2642:135 2611:doi 2571:PMC 2563:doi 2559:125 2519:doi 2515:234 2500:PDB 2266:EN2 2262:EN1 2242:BSX 2176:RAX 2112:CRX 2100:OTP 2084:ISX 2068:GSC 2062:); 2016:ARX 1780:HDX 1679:MKX 1174:in 1148:by 936:cro 905:DNA 832:in 820:in 721:DNA 220:PDB 188:PDB 58:DNA 10931:: 10841:+ 10335:T1 10313:35 10308:16 10291:4A 10286:3B 10281:3A 10271:1B 10266:1A 10243:B3 10193:Rb 9948:21 9943:18 9938:15 9933:14 9928:13 9923:12 9918:11 9913:10 9861:1B 9856:1A 9675:22 9670:21 9665:19 9540:C4 9535:C3 9530:C2 9525:C1 9176:S1 9171:R2 9166:R1 9161:Q1 9156:P4 9151:P3 9146:P2 9141:P1 9136:O6 9131:O4 9126:O3 9121:O1 9116:N4 9111:N3 9106:N2 9101:N1 9096:M1 9091:L2 9086:L1 9081:K2 9076:K1 9071:J3 9066:J2 9061:J1 9056:I3 9051:I2 9046:I1 9041:H1 9036:G1 9031:F2 9026:F1 9021:E3 9016:E1 8986:D4 8981:D3 8976:D2 8971:D1 8966:C2 8961:C1 8956:B2 8951:B1 8946:A3 8941:A2 8936:A1 8889:/ 8791:2B 8786:2A 8663:11 8636:: 8617:: 8593:20 8588:17 8583:16 8578:10 8406:1B 8401:1A 8181:EN 8020:D9 8015:D8 8010:D4 8005:D3 8000:D1 7975:C9 7970:C8 7965:C6 7960:C5 7955:C4 7945:B9 7940:B8 7935:B7 7930:B6 7925:B5 7920:B4 7915:B3 7910:B2 7905:B1 7885:A9 7880:A7 7875:A5 7870:A4 7865:A3 7860:A2 7855:A1 7653:1D 7648:1C 7643:1B 7638:1A 7400:74 7395:51 7390:44 7385:43 7380:41 7375:35 7370:34 7360:24 7355:22 7350:19 7345:10 7318:40 7313:33 7308:32 7303:21 7298:20 7293:17 7288:16 7283:11 7271:7B 7266:7A 7170:SP 7163:17 7158:15 7153:14 7148:13 7143:12 7138:11 7133:10 6988:S2 6983:S1 6861:3A 6856:2I 6414:II 5768:ID 5657:3A 5647:1A 5293:L3 5288:L2 5283:L1 5209:L1 4954:: 4889:. 4877:. 4800:. 4792:. 4780:. 4757:. 4749:. 4737:. 4714:. 4704:. 4690:. 4686:. 4668:^ 4654:. 4646:. 4634:. 4611:. 4601:. 4591:25 4589:. 4585:. 4562:. 4550:. 4524:. 4516:. 4508:. 4498:69 4496:. 4492:. 4469:. 4461:. 4449:. 4426:. 4412:. 4408:. 4385:. 4375:. 4365:68 4363:. 4359:. 4336:. 4326:. 4314:. 4310:. 4298:^ 4284:. 4272:. 4249:. 4235:. 4231:. 4208:. 4198:. 4186:. 4182:. 4159:. 4147:24 4145:. 4141:. 4118:. 4108:. 4096:. 4092:. 4069:. 4055:. 4051:. 4028:. 4018:. 4006:. 4002:. 3979:. 3969:. 3959:67 3957:. 3953:. 3930:. 3920:. 3910:35 3908:. 3904:. 3881:. 3869:87 3867:. 3863:. 3840:. 3832:. 3820:. 3797:. 3785:. 3762:. 3754:. 3746:. 3734:. 3711:. 3703:. 3693:37 3691:. 3667:. 3659:. 3649:. 3639:12 3637:. 3633:. 3610:. 3600:. 3590:. 3586:. 3582:. 3559:. 3551:. 3539:. 3516:. 3506:. 3496:26 3494:. 3490:. 3478:^ 3464:. 3456:. 3444:. 3421:. 3411:. 3401:. 3389:. 3385:. 3362:. 3352:. 3344:. 3334:. 3324:94 3322:. 3318:. 3292:. 3276:. 3253:. 3245:. 3235:92 3233:. 3210:. 3200:. 3190:35 3188:. 3184:. 3161:. 3151:. 3141:20 3139:. 3135:. 3104:. 3050:. 3042:. 3034:. 3024:37 3022:. 3018:. 2995:. 2987:. 2977:37 2975:. 2951:. 2941:. 2931:. 2921:81 2919:. 2915:. 2892:. 2884:. 2876:. 2864:. 2838:. 2834:. 2812:. 2802:. 2790:. 2786:. 2763:. 2751:. 2728:. 2718:10 2716:. 2704:^ 2674:. 2652:. 2640:. 2617:. 2607:17 2605:. 2593:^ 2579:. 2569:. 2557:. 2553:. 2539:^ 2525:. 2513:. 2502:: 2395:; 2391:; 2387:; 2383:, 2379:, 2375:; 2371:, 2367:, 2363:; 2359:, 2355:; 2351:, 2347:; 2343:, 2336:; 2332:, 2328:, 2324:; 2320:, 2316:, 2312:; 2308:, 2304:, 2300:; 2296:; 2292:; 2288:, 2284:; 2280:, 2276:; 2272:; 2268:; 2264:, 2260:; 2256:, 2252:; 2248:, 2244:; 2240:; 2236:, 2232:; 2228:, 2218:, 2214:; 2210:; 2206:; 2202:, 2198:; 2194:; 2192:2B 2186:, 2182:; 2178:, 2174:; 2170:, 2166:; 2162:; 2158:, 2154:, 2150:; 2146:, 2142:; 2138:, 2134:, 2130:, 2126:, 2122:, 2118:, 2114:; 2110:, 2106:, 2102:; 2098:; 2094:; 2090:; 2086:; 2082:; 2078:; 2074:; 2070:, 2066:; 2058:, 2056:4c 2054:, 2050:, 2046:, 2042:, 2034:, 2030:; 2026:; 2022:; 2018:; 2014:; 2010:; 2006:, 1991:, 1987:; 1983:, 1979:, 1975:; 1971:, 1967:; 1963:, 1959:, 1955:; 1951:, 1940:, 1936:; 1932:, 1928:; 1924:, 1920:, 1910:, 1906:, 1902:, 1898:, 1894:, 1883:, 1879:; 1868:, 1864:, 1860:, 1856:, 1842:; 1838:; 1834:; 1830:; 1826:; 1822:; 1818:; 1814:; 1810:; 1806:; 1802:; 1798:; 1794:; 1790:; 1786:; 1782:; 1772:, 1768:; 1764:, 1760:, 1756:, 1752:, 1748:, 1744:, 1740:, 1736:; 1732:, 1721:. 1717:, 1713:, 1709:, 1705:; 1701:, 1697:; 1693:, 1689:, 1685:, 1681:; 1677:; 1673:, 1669:, 1665:; 1661:, 1657:, 1653:, 1649:, 1645:, 1630:, 1626:, 1622:, 1618:, 1614:: 1599:, 1595:; 1591:, 1587:; 1583:, 1571:, 1567:; 1563:, 1559:, 1543:, 1539:, 1535:, 1531:, 1527:, 1523:, 1519:, 1515:, 1491:, 1487:, 1483:, 1479:, 1475:, 1471:, 1467:, 1463:, 1439:, 1435:, 1431:, 1427:, 1423:, 1419:, 1415:, 1411:, 1407:, 1383:, 1379:, 1375:, 1371:, 1367:, 1363:, 1359:, 1355:, 1351:, 1347:, 1289:. 1245:, 1237:, 872:60 808:, 757:. 696:, 692:, 665:A 199:; 195:; 178:/ 152:/ 148:/ 10541:/ 10427:e 10420:t 10413:v 10371:/ 10362:C 10357:B 10352:A 10330:3 10325:2 10276:2 10219:/ 10165:2 10160:1 10019:4 10014:3 10009:2 10004:1 9985:4 9980:3 9975:1 9908:9 9903:8 9898:6 9893:5 9888:4 9883:3 9878:2 9873:1 9844:4 9839:3 9834:2 9829:1 9817:4 9812:3 9807:2 9802:1 9738:D 9733:C 9728:B 9723:A 9660:5 9655:3 9650:2 9645:1 9598:6 9593:5 9588:4 9583:3 9578:2 9573:1 9545:5 9439:4 9434:3 9429:2 9424:1 9389:8 9384:7 9379:6 9374:5 9369:4 9364:3 9359:2 9354:1 9337:6 9332:5 9327:4 9322:1 9300:2 9295:1 9278:4 9273:3 9268:1 9251:5 9246:4 9241:2 9216:4 9211:2 9206:1 8924:5 8919:4 8914:3 8909:2 8904:1 8870:3 8865:2 8860:1 8848:2 8843:1 8769:2 8764:1 8754:9 8749:8 8744:7 8739:6 8734:5 8729:4 8724:3 8719:2 8714:1 8685:2 8680:1 8658:7 8653:6 8643:2 8638:1 8629:C 8624:B 8619:A 8573:8 8568:6 8563:3 8558:1 8544:5 8539:4 8534:3 8529:2 8524:1 8512:2 8507:1 8495:3 8490:2 8485:1 8473:2 8468:1 8451:6 8446:5 8441:4 8436:3 8431:2 8426:1 8379:3 8374:2 8369:1 8228:2 8223:1 8191:2 8186:1 8174:2 8169:1 8155:6 8150:5 8145:4 8140:3 8135:2 8130:1 8118:2 8113:1 7820:4 7815:2 7810:1 7786:2 7781:1 7658:2 7626:4 7621:2 7616:1 7569:6 7340:9 7335:7 7330:3 7244:4 7239:3 7234:2 7229:1 7195:8 7190:7 7185:4 7180:2 7175:1 7128:9 7123:8 7118:7 7113:6 7108:5 7103:4 7098:3 7093:2 7088:1 7071:3 7066:2 7054:3 7049:2 7044:1 7032:3 7027:2 7022:1 7010:2 7005:1 6973:3 6968:2 6963:1 6941:4 6936:3 6931:2 6926:1 6894:6 6851:4 6846:2 6841:1 6831:2 6826:1 6814:2 6809:1 6775:2 6771:2 6752:3 6747:2 6742:1 6730:6 6725:5 6720:4 6715:3 6710:2 6705:1 6691:4 6566:γ 6561:β 6556:α 6527:β 6522:α 6480:4 6475:2 6463:γ 6458:β 6453:α 6436:γ 6431:α 6409:I 6407:( 6376:β 6371:α 6359:γ 6354:β 6349:α 6337:γ 6332:β 6327:α 6310:γ 6300:α 6288:β 6283:α 6261:β 6256:α 6232:) 6230:4 6181:ε 6176:δ 6171:γ 6166:β 6161:α 6131:6 6126:5 6121:4 6116:3 6111:2 6106:1 6082:) 6080:4 6073:7 6068:6 6056:9 6051:5 6046:3 6041:2 6036:1 6019:X 6014:C 6009:B 6004:A 5974:2 5969:1 5865:L 5860:2 5855:1 5843:7 5838:6 5833:5 5828:4 5823:3 5818:2 5813:1 5788:4 5783:3 5778:2 5773:1 5756:9 5751:3 5746:2 5721:2 5716:1 5699:3 5694:2 5689:1 5677:3 5672:2 5667:1 5528:2 5523:1 5484:2 5479:1 5467:3 5462:2 5457:1 5445:2 5440:1 5396:2 5391:1 5348:) 5344:( 5325:3 5320:2 5315:1 5278:2 5266:K 5261:G 5256:F 5251:B 5204:3 5199:1 5187:ζ 5182:ε 5177:δ 5172:γ 5167:β 5162:α 5140:2 5135:1 5076:7 5071:6 5066:5 5061:4 5056:3 5051:2 5046:1 5029:) 5025:( 4983:e 4976:t 4969:v 4897:. 4885:: 4868:. 4841:. 4808:. 4788:: 4765:. 4753:: 4745:: 4722:. 4698:: 4692:5 4662:. 4642:: 4636:9 4619:. 4597:: 4570:. 4558:: 4535:. 4504:: 4477:. 4457:: 4451:5 4434:. 4420:: 4393:. 4371:: 4344:. 4322:: 4316:1 4292:. 4280:: 4274:3 4257:. 4243:: 4216:. 4194:: 4167:. 4153:: 4126:. 4104:: 4077:. 4063:: 4036:. 4014:: 3987:. 3965:: 3938:. 3916:: 3889:. 3875:: 3848:. 3828:: 3805:. 3793:: 3770:. 3750:: 3742:: 3719:. 3699:: 3675:. 3653:: 3645:: 3618:. 3604:: 3594:: 3588:4 3567:. 3547:: 3541:2 3524:. 3502:: 3472:. 3452:: 3446:6 3429:. 3405:: 3397:: 3391:2 3370:. 3338:: 3330:: 3303:. 3261:. 3241:: 3218:. 3196:: 3169:. 3147:: 3120:. 3090:. 3061:. 3030:: 3003:. 2983:: 2959:. 2935:: 2927:: 2900:. 2880:: 2872:: 2849:. 2820:. 2798:: 2792:2 2771:. 2759:: 2736:. 2724:: 2689:. 2660:. 2648:: 2625:. 2613:: 2587:. 2565:: 2533:. 2521:: 2399:; 2190:/ 2060:5 2052:4 2048:3 2044:2 2040:1 1995:; 1944:; 1887:; 1872:; 1128:. 20:)

Index

Homeodomain protein

Antennapedia
Drosophila melanogaster
DNA
Pfam
PF00046
Pfam
CL0123
InterPro
IPR001356
SMART
SM00389
PROSITE
PDOC00027
SCOP2
1ahd
SCOPe
SUPFAM
Pfam
structures
ECOD
PDB
RCSB PDB
PDBe
PDBj
PDBsum
structure summary
PDB
1ahd

Text is available under the Creative Commons Attribution-ShareAlike License. Additional terms may apply.