Knowledge (XXG)

Neuromedin B

Source 📝

201: 190: 180:
The sequence of the C-terminal decapeptide is highly conserved across mammalian species: GNLWATGHFM-(NH2); this decapeptide is sometimes noted as neuromedin B, but it is more accurately described as neuromedin B 23-32. The sequence of neuromedin B (in rat) is: TPFSWDLPEPRSRASKIRVHPRGNLWATGHFM-(NH2).
262:
that is attached to the receptor is activated. The G-protein is called heterotrimeric because it consists of 3 polypeptides: α subunit, β subunit, and γ subunit. In the activated NMBR/G-protein complex, there occurs an exchange of
251:
with seven transmembrane spanning regions, hence the receptor is also denoted as a 7-transmembrane receptor (7-TMR). Upon binding several intracellular signaling pathways are triggered (see
295:. CRE is the control that activates number of growth factors, and thus cell proliferation and some anti-apoptotic genes. In the brain, CREB plays a role in long-term memory and learning. 405:"Molecular cloning of cDNAs encoding the human bombesin-like peptide neuromedin B. Chromosomal localization and comparison to cDNAs encoding its amphibian homolog ranatensin" 356:"International Union of Pharmacology. LXVIII. Mammalian bombesin receptors: nomenclature, distribution, pharmacology, signaling, and functions in normal and disease states" 1040: 37: 960: 586: 1075: 61: 49: 950: 42: 965: 579: 248: 985: 558: 259: 271:
bound to G-α subunit. The G-α subunit, in turn, dissociated form the G-βγ subunits. The free G-α inactivates
446:"Neuromedin B and gastrin-releasing peptide mRNAs are differentially distributed in the rat nervous system" 1080: 1035: 572: 264: 169: 165: 54: 268: 244: 107: 181:
The (NH2) here indicates a post-translational modification -- alpha amidation of the carboxy terminus.
1010: 1005: 995: 980: 288: 275:(AC), which, in turn, catalyzes the conversion of ATP to cAMP, the latter of which functioning as a 164:
in mammals. It was originally purified from pig spinal cord, and later shown to be present in human
837: 644: 669: 534: 336: 674: 613: 526: 475: 426: 385: 328: 291:, co-activator to the CRE region of the DNA in the nucleus. CREB and CBP are held together by 272: 516: 506: 465: 457: 416: 375: 367: 320: 280: 276: 219: 102: 1000: 725: 715: 131: 111: 554: 1020: 1015: 748: 743: 720: 622: 521: 494: 470: 461: 445: 380: 355: 292: 215: 421: 404: 324: 1069: 697: 692: 659: 538: 340: 1025: 901: 896: 891: 853: 848: 599: 78: 1030: 940: 868: 843: 779: 764: 684: 654: 639: 141: 511: 1045: 832: 796: 786: 769: 735: 707: 664: 85: 495:"Sneezing reflex is mediated by a peptidergic pathway from nose to brainstem" 970: 955: 801: 791: 774: 631: 530: 389: 332: 564: 479: 430: 403:
Krane IM, Naylor SL, Helin-Davis D, Chin WW, Spindel ER (September 1988).
200: 945: 924: 919: 863: 371: 157: 90: 990: 975: 595: 493:
Li F, Jiang H, Shen X, Yang W, Guo C, Wang Z, et al. (June 2021).
161: 911: 73: 824: 199: 188: 444:
Wada E, Way J, Lebacq-Verheyden AM, Battey JF (September 1990).
284: 243:
NMB acts by binding to its high affinity cell surface receptor,
189: 66: 568: 1050: 354:
Jensen RT, Battey JF, Spindel ER, Benya RV (March 2008).
933: 910: 879: 823: 814: 757: 734: 706: 683: 630: 621: 606: 137: 127: 122: 101: 96: 84: 72: 60: 48: 36: 28: 23: 18: 311:Ohki-Hamazaki H (October 2000). "Neuromedin B". 283:(PKA). PKA enters the nucleus and activates the 1041:Pituitary adenylate cyclase-activating peptide 211:Neuromedin regulates the following functions: 961:Cocaine- and amphetamine-regulated transcript 580: 287:protein. The activated CREB binds along with 8: 820: 627: 587: 573: 565: 119: 557:at the U.S. National Library of Medicine 520: 510: 469: 420: 379: 207: : Signal Cascade after NMB binding 303: 15: 7: 409:The Journal of Biological Chemistry 196:: NMB, 7-TMR receptor and G-protein 462:10.1523/JNEUROSCI.10-09-02917.1990 14: 258:When NMB binds to its 7-TMR, the 231:blood pressure and glucose level 951:Calcitonin gene-related peptide 279:. cAMP activates of the enzyme 1: 422:10.1016/S0021-9258(18)37707-X 325:10.1016/S0301-0082(00)00004-6 285:cAMP response element-binding 1076:Genes on human chromosome 15 966:Delta-sleep-inducing peptide 239:Neuromedin signaling pathway 450:The Journal of Neuroscience 247:(NMBR). This receptor is a 1097: 512:10.1016/j.cell.2021.05.017 249:G protein-coupled receptor 986:Gastrin-releasing peptide 118: 559:Medical Subject Headings 313:Progress in Neurobiology 260:heterotrimeric G protein 360:Pharmacological Reviews 1036:Pancreatic polypeptide 208: 197: 170:gastrointestinal tract 166:central nervous system 505:(14): 3762–3773.e10. 245:neuromedin B receptor 203: 192: 981:Galanin-like peptide 372:10.1124/pr.107.07108 289:CREB binding protein 209: 198: 1063: 1062: 1059: 1058: 810: 809: 273:adenylate cyclase 151: 150: 147: 146: 1088: 821: 628: 589: 582: 575: 566: 543: 542: 524: 514: 490: 484: 483: 473: 441: 435: 434: 424: 415:(26): 13317–23. 400: 394: 393: 383: 351: 345: 344: 308: 281:Protein Kinase A 277:second messenger 228:body temperature 120: 16: 1096: 1095: 1091: 1090: 1089: 1087: 1086: 1085: 1066: 1065: 1064: 1055: 1011:Neuropeptide VF 1006:Neuropeptide SF 1001:Neuropeptide FF 996:Neuropeptide AF 929: 906: 875: 816: 806: 753: 730: 702: 679: 648: 623:Opioid peptides 617: 602: 593: 551: 546: 492: 491: 487: 443: 442: 438: 402: 401: 397: 353: 352: 348: 310: 309: 305: 301: 293:leucine zippers 241: 187: 178: 12: 11: 5: 1094: 1092: 1084: 1083: 1078: 1068: 1067: 1061: 1060: 1057: 1056: 1054: 1053: 1048: 1043: 1038: 1033: 1028: 1023: 1021:Neuropeptide Y 1018: 1016:Neuropeptide S 1013: 1008: 1003: 998: 993: 988: 983: 978: 973: 968: 963: 958: 953: 948: 943: 937: 935: 931: 930: 928: 927: 922: 916: 914: 908: 907: 905: 904: 899: 894: 889: 883: 881: 877: 876: 874: 873: 872: 871: 866: 858: 857: 856: 851: 846: 835: 829: 827: 818: 812: 811: 808: 807: 805: 804: 799: 794: 789: 784: 783: 782: 772: 767: 761: 759: 755: 754: 752: 751: 749:Leu-enkephalin 746: 744:Met-enkephalin 740: 738: 732: 731: 729: 728: 723: 718: 712: 710: 704: 703: 701: 700: 695: 689: 687: 681: 680: 678: 677: 675:β-Neoendorphin 672: 670:α-Neoendorphin 667: 662: 657: 652: 651: 650: 646: 636: 634: 625: 619: 618: 610: 608: 604: 603: 594: 592: 591: 584: 577: 569: 563: 562: 550: 549:External links 547: 545: 544: 485: 456:(9): 2917–30. 436: 395: 346: 319:(3): 297–312. 302: 300: 297: 240: 237: 236: 235: 232: 229: 226: 223: 186: 183: 177: 174: 149: 148: 145: 144: 139: 135: 134: 129: 125: 124: 116: 115: 105: 99: 98: 94: 93: 88: 82: 81: 76: 70: 69: 64: 58: 57: 52: 46: 45: 40: 34: 33: 30: 26: 25: 21: 20: 13: 10: 9: 6: 4: 3: 2: 1093: 1082: 1081:Neuropeptides 1079: 1077: 1074: 1073: 1071: 1052: 1049: 1047: 1044: 1042: 1039: 1037: 1034: 1032: 1029: 1027: 1024: 1022: 1019: 1017: 1014: 1012: 1009: 1007: 1004: 1002: 999: 997: 994: 992: 989: 987: 984: 982: 979: 977: 974: 972: 969: 967: 964: 962: 959: 957: 954: 952: 949: 947: 944: 942: 939: 938: 936: 932: 926: 923: 921: 918: 917: 915: 913: 909: 903: 900: 898: 895: 893: 890: 888: 885: 884: 882: 878: 870: 867: 865: 862: 861: 859: 855: 852: 850: 847: 845: 842: 841: 839: 836: 834: 831: 830: 828: 826: 822: 819: 817:neuropeptides 813: 803: 800: 798: 795: 793: 790: 788: 785: 781: 778: 777: 776: 773: 771: 768: 766: 763: 762: 760: 756: 750: 747: 745: 742: 741: 739: 737: 733: 727: 724: 722: 719: 717: 714: 713: 711: 709: 705: 699: 698:Endomorphin-2 696: 694: 693:Endomorphin-1 691: 690: 688: 686: 682: 676: 673: 671: 668: 666: 663: 661: 660:Big dynorphin 658: 656: 653: 649: 643: 642: 641: 638: 637: 635: 633: 629: 626: 624: 620: 616: 615: 609: 605: 601: 600:neuropeptides 597: 590: 585: 583: 578: 576: 571: 570: 567: 560: 556: 553: 552: 548: 540: 536: 532: 528: 523: 518: 513: 508: 504: 500: 496: 489: 486: 481: 477: 472: 467: 463: 459: 455: 451: 447: 440: 437: 432: 428: 423: 418: 414: 410: 406: 399: 396: 391: 387: 382: 377: 373: 369: 365: 361: 357: 350: 347: 342: 338: 334: 330: 326: 322: 318: 314: 307: 304: 298: 296: 294: 290: 286: 282: 278: 274: 270: 266: 261: 256: 254: 250: 246: 238: 233: 230: 227: 224: 221: 217: 214: 213: 212: 206: 202: 195: 191: 184: 182: 175: 173: 171: 167: 163: 159: 155: 143: 140: 136: 133: 130: 126: 121: 117: 114: 113: 109: 106: 104: 100: 95: 92: 89: 87: 83: 80: 77: 75: 71: 68: 65: 63: 59: 56: 53: 51: 47: 44: 41: 39: 35: 31: 27: 22: 17: 1026:Neurophysins 886: 854:Neurokinin B 849:Neurokinin A 685:Endomorphins 611: 555:Neuromedin+B 502: 498: 488: 453: 449: 439: 412: 408: 398: 363: 359: 349: 316: 312: 306: 257: 252: 242: 210: 204: 193: 179: 154:Neuromedin B 153: 152: 110: 19:neuromedin B 1031:Neurotensin 941:Angiotensin 880:Neuromedins 869:Physalaemin 844:Substance P 838:Tachykinins 833:Bradykinins 780:Hemorphin-4 765:Adrenorphin 736:Enkephalins 726:γ-Endorphin 721:β-Endorphin 716:α-Endorphin 655:Dynorphin B 645:Dynorphin A 640:Dynorphin A 366:(1): 1–42. 225:cell growth 156:(NMB) is a 132:Swiss-model 24:Identifiers 1070:Categories 860:amphibian 797:Spinorphin 787:Nociceptin 770:Amidorphin 708:Endorphins 665:Leumorphin 632:Dynorphins 299:References 222:secretions 128:Structures 123:Search for 97:Other data 971:FMRFamide 956:Carnosine 840:: mammal 802:Valorphin 792:Opiorphin 775:Hemorphin 539:235430434 220:endocrine 160:-related 79:NM_021077 38:NCBI gene 946:Bombesin 864:Kassinin 614:hormones 607:Hormones 596:Peptides 531:34133943 390:18055507 341:23673653 333:10840151 253:Figure 2 234:sneezing 216:exocrine 205:Figure 2 194:Figure 1 185:Function 176:Sequence 158:bombesin 142:InterPro 112:q11-qter 1046:RVD-Hpα 991:Ghrelin 976:Galanin 912:Orexins 522:8396370 480:2398368 471:6570249 431:2458345 381:2517428 162:peptide 138:Domains 108:Chr. 15 86:UniProt 825:Kinins 758:Others 561:(MeSH) 537:  529:  519:  478:  468:  429:  388:  378:  339:  331:  91:P08949 74:RefSeq 67:162340 29:Symbol 934:Other 815:Other 535:S2CID 337:S2CID 103:Locus 612:see 527:PMID 499:Cell 476:PMID 427:PMID 386:PMID 329:PMID 267:for 218:and 168:and 62:OMIM 55:7842 50:HGNC 43:4828 1051:VGF 647:1–8 517:PMC 507:doi 503:184 466:PMC 458:doi 417:doi 413:263 376:PMC 368:doi 321:doi 269:GDP 265:GTP 255:). 32:NMB 1072:: 598:: 533:. 525:. 515:. 501:. 497:. 474:. 464:. 454:10 452:. 448:. 425:. 411:. 407:. 384:. 374:. 364:60 362:. 358:. 335:. 327:. 317:62 315:. 172:. 925:B 920:A 902:U 897:S 892:N 887:B 588:e 581:t 574:v 541:. 509:: 482:. 460:: 433:. 419:: 392:. 370:: 343:. 323::

Index

NCBI gene
4828
HGNC
7842
OMIM
162340
RefSeq
NM_021077
UniProt
P08949
Locus
Chr. 15
q11-qter
Swiss-model
InterPro
bombesin
peptide
central nervous system
gastrointestinal tract


exocrine
endocrine
neuromedin B receptor
G protein-coupled receptor
heterotrimeric G protein
GTP
GDP
adenylate cyclase
second messenger

Text is available under the Creative Commons Attribution-ShareAlike License. Additional terms may apply.